Recombinant Full Length Saccharomyces Cerevisiae Cell Wall Integrity And Stress Response Component 4(Wsc4) Protein, His-Tagged
Cat.No. : | RFL6918SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Cell wall integrity and stress response component 4(WSC4) Protein (P38739) (27-605aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (27-605) |
Form : | Lyophilized powder |
AA Sequence : | TQSVCSSQNTATTDGVRNQFQSNGWCSNNCAGHQFAIVQGFMCWCSDSEPSTQTSVGDCS GTCPGYGYEDCGNADKDLFGYIYLGQTPLSSVQSVETSTESSVYVSSSSITSSSSTSIVD TTTISPTLTSTSTTPLTTASTSTTPSTDITSALPTTTSTKLSTSIPTSTTSSTSTTTSTS SSTSTTVSVTSSTSTTTSTTSSTLISTSTSSSSSSTPTTTSSAPISTSTTSSTSTSTSTT SPTSSSAPTSSSNTTPTSTTFTTTSPSTAPSSTTVTYTSTTASPITSTITSVNLQTSLKY SVITVTSVHTMDTNISEITSRYLTMKKVITQIYSSTLGATPTSAVATTSASVGGRITNNN NSNTTNSNTPTNKSTEKKGYWDSPGKIAATFVVVGVVCLVIICILIYLIHHYRTRPARKA QDFENEYQSKFYQSKYPNEVTTTTLHTPSPSSNSTFSTPRLIYTDEKGQIMSESPSPRQS TYSLTAGSPPNDPSTLASPFHDPILPRRTSTFLHSPIQKQHEKMESNVTLGEDTVLVDQR LDPSKMLNTLANDDATNHSTISLSDNVDYSRRVLRLMNE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | WSC4 |
Synonyms | WSC4; YHL028W; Cell wall integrity and stress response component 4 |
UniProt ID | P38739 |
◆ Recombinant Proteins | ||
SE2085-3248S | Recombinant Staphylococcus epidermidis ATCC 12228 SE2085 protein, His-tagged | +Inquiry |
CXCR4-1083HFL | Recombinant Human CXCR4 protein, His&Flag-tagged | +Inquiry |
YVRO-1966B | Recombinant Bacillus subtilis YVRO protein, His-tagged | +Inquiry |
gB-1698V | Recombinant VZV gB Protein | +Inquiry |
Gp120-545H | Recombinant HIV-1 (group M, subtype B, strain SHIV-89.6P) gp120 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen Type I-11M | Native Mouse Collagen Type I Protein | +Inquiry |
Fxa-282B | Active Native Bovine Factor Xa - EGR | +Inquiry |
DNA-005C | Native Calf DNA | +Inquiry |
Lectin-1844S | Active Native Solanum Tuberosum Lectin Protein | +Inquiry |
TF-103H | Native Human Apotransferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
SFRP4-2849MCL | Recombinant Mouse SFRP4 cell lysate | +Inquiry |
ZNF614-2064HCL | Recombinant Human ZNF614 cell lysate | +Inquiry |
GHR-2401MCL | Recombinant Mouse GHR cell lysate | +Inquiry |
ENG-2267MCL | Recombinant Mouse ENG cell lysate | +Inquiry |
RNF111-1516HCL | Recombinant Human RNF111 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All WSC4 Products
Required fields are marked with *
My Review for All WSC4 Products
Required fields are marked with *
0
Inquiry Basket