Recombinant Full Length Saccharomyces Cerevisiae Autophagy-Related Protein 32(Atg32) Protein, His-Tagged
Cat.No. : | RFL3433SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Autophagy-related protein 32(ATG32) Protein (C7GUR3) (1-529aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-529) |
Form : | Lyophilized powder |
AA Sequence : | MVLEYQQREGKGSSSKSMPPDSSSTTIHTCSEAQTGEDKGLLDPHLSVLELLSKTGHSPS PMGQNLVTSIDISGNHNVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTSE EEQELLQAPAADIINIIKQGQEGANVVSPSHPFKQLQKIISLPLPGKEKTPFNEQDDDGD EDEAFEEDSVTITKSLTSSTNSFVMPKLSLTQKNPVFRLLILGRTGSSFYQSIPKEYQSL FELPKYHDSATFPQYTGIVIIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQVKNVL KSFLRNKLVKLLFPPVVVTNKRDLKKMFQRLQDLSLEYGEDVNEEDNDDEAIHTKSRSYC RNKKAENSKKKSPKSNKKPKRKKQKFFTSWFTWGISITIGISFGCCVTYFVTAAYEHQTV KSLSLRPSILASLLSLDSSSDTINTPATASPSSTEQFLWFDKGTLQINFHSDGFIMKSLT IIKETWGKMNTFVLHALSKPLKFLENLNKSSEFSIDESNRILALGYILL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATG32 |
Synonyms | ATG32; ECM17; C1Q_04175; Autophagy-related protein 32; Extracellular mutant protein 37 |
UniProt ID | C7GUR3 |
◆ Recombinant Proteins | ||
RFL20440HF | Recombinant Full Length Human Transmembrane Protein 126B(Tmem126B) Protein, His-Tagged | +Inquiry |
PIP4K2A-167H | Active Recombinant Human PIP4K2A protein, GST-tagged | +Inquiry |
SPCS3-4430R | Recombinant Rhesus monkey SPCS3 Protein, His-tagged | +Inquiry |
LIPE-3417R | Recombinant Rat LIPE Protein | +Inquiry |
EMX3-8871Z | Recombinant Zebrafish EMX3 | +Inquiry |
◆ Native Proteins | ||
ALB-311H | Native Human Albumin, Texas Red Label | +Inquiry |
F9-266B | Active Native Bovine Factor IX | +Inquiry |
PROC-273B | Active Native Bovine Protein C - DEGR (active site blocked) | +Inquiry |
Deoxycholate-03T | Native Toxoplasma Gondii Deoxycholate Lysate, RH strain | +Inquiry |
LDHA-26867TH | Native Human LDHA | +Inquiry |
◆ Cell & Tissue Lysates | ||
YIF1A-247HCL | Recombinant Human YIF1A 293 Cell Lysate | +Inquiry |
GPIHBP1-5805HCL | Recombinant Human GPIHBP1 293 Cell Lysate | +Inquiry |
COQ10B-7349HCL | Recombinant Human COQ10B 293 Cell Lysate | +Inquiry |
FAM165B-6412HCL | Recombinant Human FAM165B 293 Cell Lysate | +Inquiry |
RAB23-2618HCL | Recombinant Human RAB23 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ATG32 Products
Required fields are marked with *
My Review for All ATG32 Products
Required fields are marked with *
0
Inquiry Basket