Recombinant Full Length Saccharomyces Cerevisiae Autophagy-Related Protein 32(Atg32) Protein, His-Tagged
Cat.No. : | RFL12770SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae Autophagy-related protein 32(ATG32) Protein (A6ZVD0) (1-529aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-529) |
Form : | Lyophilized powder |
AA Sequence : | MVLEYQQREGKGSSSKSMPPDSSSTTIHTCSEAQTGEDKGLLDPHLSVLELLSKTGHSPS PMGQNLVTSIDISGNHNVNDSISGSWQAIQPLDLGASFIPERCSSQTTNGSILSSSDTSE EEQELLQAPAADIINIIKQGQEGANVVSPSHPFKQLQKIISLPLPGKEKTPFNEQDDDGD EDEAFEEDSVTITKSLTSSTNSFVMPKLSLTQKNPVFRLLILGRTGSSFYQSIPKEYQSL FELPKYHDSATFPQYTGIVIIFQELREMVSLLNRIVQYSQGKPVIPICQPGQVIQVKNVL KSFLRNKLVKLLFPPVVVTNKRDLKKMFQRLQDLSLEYGEDVNEEDNDDEAIHTKSRSYC RNKKAENSKKKSPKSNKKPKRKKQKFFTSWFTWGISITIGISFGCCVTYFVTAAYEHQTV KSLSLRPSILASLLSLDSSSDTINTPATASPSSTEQFLWFDKGTLQINFHSDGFIMKSLT IIKETWGKMNTFVLHALSKPLKFLENLNKSSEFSIDESNRILALGYILL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ATG32 |
Synonyms | ATG32; ECM17; SCY_2646; Autophagy-related protein 32; Extracellular mutant protein 37 |
UniProt ID | A6ZVD0 |
◆ Recombinant Proteins | ||
SGMS2-7321Z | Recombinant Zebrafish SGMS2 | +Inquiry |
PPARD-1089H | Active Recombinant Human PPARD, Ligand Binding Domain | +Inquiry |
CD86-27891TH | Recombinant Human CD86 | +Inquiry |
VSP13a-3692Y | Recombinant Yeast VSP13a, GST-tagged | +Inquiry |
EOGT-0045H | Recombinant Human EOGT Protein, GST-Tagged | +Inquiry |
◆ Native Proteins | ||
CTSB-1647H | Native Human Cathepsin B | +Inquiry |
COL2A1-1648H | Native Human COL2A1 Protein | +Inquiry |
C1S-550H | Active Native Human C1S Enzyme | +Inquiry |
Pzp-3279H | Native Human Pzp | +Inquiry |
PLD-17S | Active Native Streptomyces chromofuscus Phospholipase D | +Inquiry |
◆ Cell & Tissue Lysates | ||
RGS12-1501HCL | Recombinant Human RGS12 cell lysate | +Inquiry |
ATP2A2-8609HCL | Recombinant Human ATP2A2 293 Cell Lysate | +Inquiry |
GABRB1-6062HCL | Recombinant Human GABRB1 293 Cell Lysate | +Inquiry |
ELAVL2-246HCL | Recombinant Human ELAVL2 lysate | +Inquiry |
CNOT10-375HCL | Recombinant Human CNOT10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All ATG32 Products
Required fields are marked with *
My Review for All ATG32 Products
Required fields are marked with *
0
Inquiry Basket