Recombinant Full Length Saccharomyces Cerevisiae 3-Ketoacyl-Coa Reductase (Scy_0371) Protein, His-Tagged
Cat.No. : | RFL20173SF |
Product Overview : | Recombinant Full Length Saccharomyces cerevisiae 3-ketoacyl-CoA reductase (SCY_0371) Protein (A6ZLA1) (1-347aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | S.cerevisiae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-347) |
Form : | Lyophilized powder |
AA Sequence : | MTFMQQLQEAGERFRCINGLLWVVFGLGVLKCTTLSLRFLALIFDLFLLPAVNFDKYGAK SGKYCVITGASDGIGKEFARQMAKRGFNLVLISRTQSKLEALQKELEDQHHVVVKILAID IAEDKESNYESIKELCAQLPITVLVNNVGQSHSIPVPFLETEEKELRDIITINNTATLLI TQIIAPKIVETVKAENKKSGTRGLILTMGSFGGLIPTPLLATYSGSKSFLQSWSNSLAGE LSKDAIDVELIISYLVTSSMSKIRRSSLMIPNPQQFVKSTLRSVGRRCGSQERYATMTPY WAHAVYQFVITETFGVYSKIVNSINYSFHKSIRIRALKKAARQVKKE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | SCY_0371 |
Synonyms | SCY_0371; Very-long-chain 3-oxoacyl-CoA reductase; 3-ketoacyl-CoA reductase; 3-ketoreductase; KAR; Microsomal beta-keto-reductase |
UniProt ID | A6ZLA1 |
◆ Native Proteins | ||
TNNI3-01H | Native Human TNNI3 Protein | +Inquiry |
HNMT-1355R | Active Native Rat HNMT Protein | +Inquiry |
NEFM-179B | Native bovine NEFM | +Inquiry |
AMY1A-5329H | Native Human Amylase, Alpha 1A (salivary) | +Inquiry |
Transglutaminase-88G | Active Native Guinea pig liver Transglutaminase | +Inquiry |
◆ Cell & Tissue Lysates | ||
EXOC5-6509HCL | Recombinant Human EXOC5 293 Cell Lysate | +Inquiry |
FBXL5-6310HCL | Recombinant Human FBXL5 293 Cell Lysate | +Inquiry |
ZBTB3-216HCL | Recombinant Human ZBTB3 293 Cell Lysate | +Inquiry |
VCY1B-731HCL | Recombinant Human VCY1B lysate | +Inquiry |
MOBKL1A-4266HCL | Recombinant Human MOBKL1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SCY_0371 Products
Required fields are marked with *
My Review for All SCY_0371 Products
Required fields are marked with *
0
Inquiry Basket