Recombinant Full Length Rubella Virus Structural Polyprotein Protein, His-Tagged
Cat.No. : | RFL19077RF |
Product Overview : | Recombinant Full Length Rubella virus Structural polyprotein Protein (Q6X2U3) (583-1063aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | RUBV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (583-1063) |
Form : | Lyophilized powder |
AA Sequence : | EEAFTYLCTAPGCATQTPVPVRLAGVRFESKIVDGGCFAPWDLEATGACICEIPTDVSCE GLGAWVPAAPCARIWNGTQRACTLWAVNAYSSGGYAQLASYFNPGGSYYKQYHPTACDVE PAFGHSDAACWGFPTDTVMSVFALASYVQHPDKTVRVKFHTETRTVWQLSVAGVSCNVTT EHPFCNTPHGQLEVQVPPDPGDLVEYIMNYTGNQQSRWGLGSPNCHGPDWASPVCQRHSP DCSRLVGATPERPRLRLVDADDPLLRTAPGPGEVWVTPVIGSQARKCGLHIRAGPYGHAT VEMPEWIHAHTTSDPWHPPGPLGLKFKTVRPVALPRALAPPRNVRVTGCYQCGTPALVEG LAPGGGNCHLTVNGEDVGAFPPGKFVTAALLNTPPPYQVSCGGESDRASARVIDPAAQSF TGVVYGTHTTAVSETRQTWAEWAAAHWWQLTLGAICALLLAGLLACCAKCLYYLRGAIAP R |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Rubella virus Structural polyprotein |
Synonyms | Structural polyprotein; p110 |
UniProt ID | Q6X2U3 |
◆ Recombinant Proteins | ||
CEACAM6-179H | Recombinant Human CEACAM6 Protein, His-tagged | +Inquiry |
SUC-0018-4314S | Recombinant Staphylococcus aureus (strain: 18806) SUC_0018 protein, His-tagged | +Inquiry |
RFL27553HF | Recombinant Full Length Human Oxidized Low-Density Lipoprotein Receptor 1(Olr1) Protein, His-Tagged | +Inquiry |
POLR2H-13098M | Recombinant Mouse POLR2H Protein | +Inquiry |
FERD3L-1688R | Recombinant Rhesus monkey FERD3L Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
S100A1B-9H | Native Human S100A1B | +Inquiry |
PLAU-31777TH | Native Human Human SERPINE1 | +Inquiry |
Copper containing Amine oxidase-004B | Active Native Bovine Copper containing Amine oxidase Protein | +Inquiry |
PLF4-88H | Active Native Human PF 4 | +Inquiry |
FGA-6H | Native Human Fibrinogen Protein, Alexa Fluor 488 labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CD80-1767MCL | Recombinant Mouse CD80 cell lysate | +Inquiry |
Lymphoma-334H | Human Lymphoma, Hodgkins Disease Membrane Tumor Lysate | +Inquiry |
LDHAL6B-4789HCL | Recombinant Human LDHAL6B 293 Cell Lysate | +Inquiry |
MDS1-1072HCL | Recombinant Human MDS1 cell lysate | +Inquiry |
RFXAP-1496HCL | Recombinant Human RFXAP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Rubella virus Structural polyprotein Products
Required fields are marked with *
My Review for All Rubella virus Structural polyprotein Products
Required fields are marked with *
0
Inquiry Basket