Recombinant Full Length Rubella Virus Structural Polyprotein Protein, His-Tagged
Cat.No. : | RFL4020RF |
Product Overview : | Recombinant Full Length Rubella virus Structural polyprotein Protein (P08563) (583-1063aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | RUBV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (583-1063) |
Form : | Lyophilized powder |
AA Sequence : | EEAFTYLCTAPGCATQTPVPVRLAGVRFESKIVDGGCFAPWDLEATGACICEIPTDVSCE GLGAWVPTAPCARIWNGTQRACTFWAVNAYSSGGYAQLASYFNPGGSYYKQYHPTACEVE PAFGHSDAACWGFPTDTVMSVFALASYVQHPHKTVRVKFHTETRTVWQLSVAGVSCNVTT EHPFCNTPHGQLEVQVPPDPGDLVEYIMNYTGNQQSRWGLGSPNCHGPDWASPVCQRHSP DCSRLVGATPERPRLRLVDADDPLLRTAPGPGEVWVTPVIGSQARKCGLHIRAGPYGHAT VEMPEWIHAHTTSDPWHPPGPLGLKFKTVRPVALPRALAPPRNVRVTGCYQCGTPALVEG LAPGGGNCHLTVNGEDVGAFPPGKFVTAALLNTPPPYQVSCGGESDRASARVIDPAAQSF TGVVYGTHTTAVSETRQTWAEWAAAHWWQLTLGAICALLLAGLLACCAKCLYYLRGAIAP R |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Rubella virus Structural polyprotein |
Synonyms | Structural polyprotein; p110 |
UniProt ID | P08563 |
◆ Native Proteins | ||
CII-250C | Native Chicken CII | +Inquiry |
HP-7761R | Native Rabbit Haptoglobin Protein | +Inquiry |
AC-63B | Native Bovine Activated Protein C | +Inquiry |
INS-5435B | Native Bovine Insulin | +Inquiry |
IgG-013L | Native Llama IgG, Protein G Purified | +Inquiry |
◆ Cell & Tissue Lysates | ||
MED8-4378HCL | Recombinant Human MED8 293 Cell Lysate | +Inquiry |
Brain-85M | Mouse Brain Tissue Lysate (14 Days Old) | +Inquiry |
ARFIP1-8750HCL | Recombinant Human ARFIP1 293 Cell Lysate | +Inquiry |
PPP6R3-2066HCL | Recombinant Human SAPS3 293 Cell Lysate | +Inquiry |
LY86-1276HCL | Recombinant Human LY86 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Rubella virus Structural polyprotein Products
Required fields are marked with *
My Review for All Rubella virus Structural polyprotein Products
Required fields are marked with *
0
Inquiry Basket