Recombinant Full Length Rubella Virus Structural Polyprotein Protein, His-Tagged
Cat.No. : | RFL21224RF |
Product Overview : | Recombinant Full Length Rubella virus Structural polyprotein Protein (P07566) (583-1063aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | RUBV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (583-1063) |
Form : | Lyophilized powder |
AA Sequence : | EEAFTYLCTAPGCATQAPVPVRLAGVRFESKIVDGGCFAPWDLEATGACICEIPTDVSCE GLGAWVPAAPCARIWNGTQRACTFWAVNAYSSGGYAQLASYFNPGGSYYKQYHPTACEVE PAFGHSDAACWGFPTDTVMSVFALASYVQHPHKTVRVKFHTETRTVWQLSVAGVSCNVTT EHPFCNTPHGQLEVQVPPDPGDLVEYIMNYTGNQQSRWGLGSPNCHGPDWASPVCQRHSP DCSRLVGATPERPRLRLVDADDPLLRTAPGPGEVWVTPVIGSQARKCGLHIRAGPYGHAT VEMPEWIHAHTTSDPWHPPGPLGLKFKTVRPVALPRTLAPPRNVRVTGCYQCGTPALVEG LAPGGGNCHLTVNGEDLGAVPPGKFVTAALLNTPPPYQVSCGGESDRATARVIDPAAQSF TGVVYGTHTTAVSETRQTWAEWAAAHWWQLTLGAICALPLAGLLACCAKCLYYLRGAIAP R |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Rubella virus Structural polyprotein |
Synonyms | Structural polyprotein; p110 |
UniProt ID | P07566 |
◆ Native Proteins | ||
CDA015 | Native Hepatitis B Surface Ag protein | +Inquiry |
GPT-26882TH | Native Human GPT | +Inquiry |
FGA-42D | Native Canine Fibrinogen, FITC Labeled | +Inquiry |
GPT-188S | Active Native Swine Glutamate Pyruvate Transaminase | +Inquiry |
PNLIP-1175P | Native Porcine Pancreatic Lipase | +Inquiry |
◆ Cell & Tissue Lysates | ||
LCK-681HCL | Recombinant Human LCK cell lysate | +Inquiry |
TRIM61-764HCL | Recombinant Human TRIM61 293 Cell Lysate | +Inquiry |
TCEANC2-8145HCL | Recombinant Human C1orf83 293 Cell Lysate | +Inquiry |
PQLC2-2901HCL | Recombinant Human PQLC2 293 Cell Lysate | +Inquiry |
MYL3-4027HCL | Recombinant Human MYL3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Rubella virus Structural polyprotein Products
Required fields are marked with *
My Review for All Rubella virus Structural polyprotein Products
Required fields are marked with *
0
Inquiry Basket