Recombinant Full Length Rickettsia Felis Putative Export Atp-Binding/Permease Protein Rf_0214(Rf_0214) Protein, His-Tagged
Cat.No. : | RFL18311RF |
Product Overview : | Recombinant Full Length Rickettsia felis Putative export ATP-binding/permease protein RF_0214(RF_0214) Protein (Q4UMZ3) (1-576aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rickettsia felis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-576) |
Form : | Lyophilized powder |
AA Sequence : | MDIKLLYRLIKYLKFYKKDLIIVMISLLSVSASLLLIGSVFRNLVDNGLSQNHILSVDKS ILYICLLIIILSIASFFRSYFINNVAEKAVNQIRKDAYSNLITYEIEEFEELKIGDIISR LTNDIDQISTLIVNFLSFFIRNSVMLIGGVTLMFFESFKLASIVIITIPILLIPLIKFGK HVKALSKKALESKSLLASDIDETFNNIRAIYAFNNQTNKITDFDTKLQNYLTYCKTRLKI RALFFAISIAIIFLAITLVVWIGASDIVKGNLSAGQIISFIYYAIIAGFSSGGIFELLSE IHLPLAALERIITIIDKTPITHNSYLELNNSDPISIEFKNVDFTYHSRPNLRIINNMSLK INADKFIGIVGRSGGGKSTLMQLLLRFYRQESGTILINNQDITLSNPAEIRKLIAYVPQE ANIFSGTIKSNIIFGNTQASDDDINEIIKITGIEEFAAKLHDGINAKIGERGVRLSGGQK QRIAIARALLRKPQILLLDEAMSALDTMSEQKLLESIKEIMKGKIIISIAHRISSIESAD YILVIDKGGVAASGSHNDLSKNSEIYRNICREQLTV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RF_0214 |
Synonyms | RF_0214; Putative export ATP-binding/permease protein RF_0214 |
UniProt ID | Q4UMZ3 |
◆ Recombinant Proteins | ||
DMRTA1-2417M | Recombinant Mouse DMRTA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
HDAC3-4643H | Recombinant Human HDAC3 Protein, GST-tagged | +Inquiry |
TMEM117-4767R | Recombinant Rhesus monkey TMEM117 Protein, His-tagged | +Inquiry |
IL4-313H | Active Recombinant Human IL4, Fc-tagged | +Inquiry |
OAF-3147R | Recombinant Rhesus monkey OAF Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
ung-8332E | Native E.coli ung | +Inquiry |
Chylomicrons-192H | Native Human Chylomicrons | +Inquiry |
FGB-35D | Native Canine Fibrinogen | +Inquiry |
CDA007 | Native Human Cancer Antigen 72-4 | +Inquiry |
Y. enterocolitica-31 | Native Yersinia enterocolitica O:9 Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
PYY-2641HCL | Recombinant Human PYY 293 Cell Lysate | +Inquiry |
WDR1-357HCL | Recombinant Human WDR1 293 Cell Lysate | +Inquiry |
ENPP2-1556HCL | Recombinant Human ENPP2 cell lysate | +Inquiry |
C15orf23-8269HCL | Recombinant Human C15orf23 293 Cell Lysate | +Inquiry |
MRPL33-4179HCL | Recombinant Human MRPL33 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RF_0214 Products
Required fields are marked with *
My Review for All RF_0214 Products
Required fields are marked with *
0
Inquiry Basket