Recombinant Full Length Xenopus Laevis Lysophosphatidic Acid Receptor 1-A(Lpar1-A) Protein, His-Tagged
Cat.No. : | RFL6241XF |
Product Overview : | Recombinant Full Length Xenopus laevis Lysophosphatidic acid receptor 1-A(lpar1-a) Protein (Q9PU17) (1-366aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Xenopus laevis |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-366) |
Form : | Lyophilized powder |
AA Sequence : | MASLSEFVSEPISMMSQTSAASESQCYYNETIAFFYNRSGKYLATEWNAVSKLVMGLGIT VCIFIMLANLLVMVAIYVNRRFHFPIYYLMANLAAADFFAGLAYFYLMFNTGPNTRRLTV STWLLRQGLIDTSLTASVANLLAIAIERHITVFRMQLHTRMSNRRVVVVIVVIWTVAIVM GAIPSVGWNCICDLEQCSNMAPLYSDSYLIFWTIFNLVTFVVMVVLYAHIFVYVRQKTMR MSRHSSGPRRNRDTMMSLLKTVVIVLGAFIVCWTPGLVLLLLDICCPQCNILAYEKFFLL LAEFNSAMNPIIYSYRDKEMSATFKQILCCQRTENVNGPTEGSDRSASSLNHTILAGVHS NDHSVV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | lpar1-a |
Synonyms | lpar1-a; lpa1r; lpa1r1; Lysophosphatidic acid receptor 1-A; LPA receptor 1-A; LPA-1-A; Lysophosphatidic acid receptor LPA1 homolog 1; xLPA1-1 |
UniProt ID | Q9PU17 |
◆ Recombinant Proteins | ||
YUXO-1251B | Recombinant Bacillus subtilis YUXO protein, His-tagged | +Inquiry |
CGRRF1-1017R | Recombinant Rat CGRRF1 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL27405MF | Recombinant Full Length Mouse Mitochondrial Carrier Homolog 1(Mtch1) Protein, His-Tagged | +Inquiry |
SH3BGRL3-10612Z | Recombinant Zebrafish SH3BGRL3 | +Inquiry |
MYL9B-12418Z | Recombinant Zebrafish MYL9B | +Inquiry |
◆ Native Proteins | ||
SRC-29697TH | Native Human SRC | +Inquiry |
ALB-108C | Native Cynomolgus Monkey Albumin | +Inquiry |
MV-02 | Native Measles Virus Antigen | +Inquiry |
KRT18-173B | Native bovine KRT18 | +Inquiry |
LDH5-8342H | Native Human LDH5 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PBX2-474HCL | Recombinant Human PBX2 lysate | +Inquiry |
C20orf7-8112HCL | Recombinant Human C20orf7 293 Cell Lysate | +Inquiry |
TMOD3-915HCL | Recombinant Human TMOD3 293 Cell Lysate | +Inquiry |
FAM126B-6435HCL | Recombinant Human FAM126B 293 Cell Lysate | +Inquiry |
AGL-8979HCL | Recombinant Human AGL 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All lpar1-a Products
Required fields are marked with *
My Review for All lpar1-a Products
Required fields are marked with *
0
Inquiry Basket