Recombinant Full Length Rickettsia Bellii Putative Na(+)/H(+) Antiporter Nhaa Homolog Protein, His-Tagged
Cat.No. : | RFL16266RF |
Product Overview : | Recombinant Full Length Rickettsia bellii Putative Na(+)/H(+) antiporter nhaA homolog Protein (A8GYC5) (1-168aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rickettsia bellii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-168) |
Form : | Lyophilized powder |
AA Sequence : | MVEAGIHGTLCGAIIALFIPVNIKGQINSSFHKLEKLIQPFVNYFILPLFVFMNSGVLLK DFSFRSVCSSLTFGIILGLFIGKQLGVMLFSYPCVKFNFCSLPSNTSWLKFYSIAILGGI GFTLSLFIGGITFEGGCPSNSMRVAVIIGSLLSALFGILVMRYCTKSK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nhaA |
Synonyms | nhaA; A1I_07885; Putative Na(+/H(+ antiporter NhaA homolog |
UniProt ID | A8GYC5 |
◆ Native Proteins | ||
APOA1-256H | Native Human APOA1 protein | +Inquiry |
Factor XIIIa-68H | Native Human Factor XIIIa protein | +Inquiry |
TRPM2-8450H | Native Human TRPM2 | +Inquiry |
CEACAM5-27803TH | Native Human CEACAM5 | +Inquiry |
ALB-21H | Native Human ALB protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE2I-573HCL | Recombinant Human UBE2I 293 Cell Lysate | +Inquiry |
EEPD1-920HCL | Recombinant Human EEPD1 cell lysate | +Inquiry |
Testis-792D | Dog Testis Membrane Lysate, Total Protein | +Inquiry |
SREK1-1908HCL | Recombinant Human SFRS12 293 Cell Lysate | +Inquiry |
MLYCD-1119HCL | Recombinant Human MLYCD cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All nhaA Products
Required fields are marked with *
My Review for All nhaA Products
Required fields are marked with *
0
Inquiry Basket