Recombinant Full Length Rickettsia Akari Putative Na(+)/H(+) Antiporter Nhaa Homolog Protein, His-Tagged
Cat.No. : | RFL6384RF |
Product Overview : | Recombinant Full Length Rickettsia akari Putative Na(+)/H(+) antiporter nhaA homolog Protein (A8GQA2) (1-68aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rickettsia akari |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-68) |
Form : | Lyophilized powder |
AA Sequence : | MVVHALIYIFFNYDKPGLIKGWAVPIATDTAFVLGIVSFFSRHISLELRTFIIGFSLIDD AFAPIILS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | nhaA |
Synonyms | nhaA; A1C_06770; Putative Na(+/H(+ antiporter NhaA homolog |
UniProt ID | A8GQA2 |
◆ Recombinant Proteins | ||
il4-22Z | Recombinant Zebrafish il4 protein | +Inquiry |
C3-338C | Recombinant Cattle C3 Protein, His-tagged | +Inquiry |
NOVA2-1272H | Recombinant Human NOVA2 Protein, MYC/DDK-tagged | +Inquiry |
CD69-1801R | Recombinant Rhesus Monkey CD69 Protein | +Inquiry |
AIF1-0310H | Recombinant Human AIF1 Protein (Ser2-Pro147), C-His-tagged | +Inquiry |
◆ Native Proteins | ||
GG-183H | Native Human Gamma Globulin | +Inquiry |
ATF-181R | Native Rat Apotransferrin | +Inquiry |
ITGB3-11H | Native Human GPIIbIIIa | +Inquiry |
SOD1-102B | Active Native Bovine SOD, modified | +Inquiry |
PRSS1-30745TH | Active Native Human PRSS1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
DLX3-6906HCL | Recombinant Human DLX3 293 Cell Lysate | +Inquiry |
FLT3LG-1387MCL | Recombinant Mouse FLT3LG cell lysate | +Inquiry |
CASC4-7843HCL | Recombinant Human CASC4 293 Cell Lysate | +Inquiry |
FLT4-2709HCL | Recombinant Human FLT4 cell lysate | +Inquiry |
DOC2B-502HCL | Recombinant Human DOC2B cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All nhaA Products
Required fields are marked with *
My Review for All nhaA Products
Required fields are marked with *
0
Inquiry Basket