Recombinant Full Length Rhodospirillum Rubrum Upf0761 Membrane Protein Rru_A2625(Rru_A2625) Protein, His-Tagged
Cat.No. : | RFL32329RF |
Product Overview : | Recombinant Full Length Rhodospirillum rubrum UPF0761 membrane protein Rru_A2625(Rru_A2625) Protein (Q2RR23) (1-440aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhodospirillum rubrum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-440) |
Form : | Lyophilized powder |
AA Sequence : | MVDDENRRRGLLGRRSHARSWLPVKPRRILATAGSFTILVLRALITHDIPRLAASLAYTS LLALVPLIAIALAILAAFPGFGDERERMVAWIIETFVPYRRTEILDQVEHFVGAAAGLTA LGVAGLTLTAIILLLTIESSLNAIFRVEKSRHPLARLLVYWSVLTGGPLLMGLSFSLSSY LVAIRHLVGTDVMSPFDALTPTLGPPLLSLTAMTLLYMLVPNRPVPLFHALAGALVATLA SALLRSAFLMVITRGLSYETLYGALAALPAFLVWMYLSWAVVLMGAVTAAEIPNWKMARR LTRAGQDERAARLRIAVEIMVAAARAYGEGQGDGASRRALSALTATPDRRQAGVLRDLDK AGLLIRDEDGAVLPGRDPRRITLAEILHALTLAPPTGTVGGPGWPDLLRHALETAGGDYD RALGLSLDALVQAEPLGARI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Rru_A2625 |
Synonyms | Rru_A2625; UPF0761 membrane protein Rru_A2625 |
UniProt ID | Q2RR23 |
◆ Recombinant Proteins | ||
RFL12108EF | Recombinant Full Length Alpha-Hemolysin Translocation Atp-Binding Protein Hlyb(Hlyb) Protein, His-Tagged | +Inquiry |
SERPINH1-1516M | Recombinant Mouse SERPINH1 Protein (18-417 aa), His-tagged | +Inquiry |
Vegfd-569R | Recombinant Rat Vegfd Protein, His-tagged | +Inquiry |
BD1-5653R | Recombinant Red bryony BD1 protein, His-tagged | +Inquiry |
CCPG1-5139H | Recombinant Human CCPG1 Protein | +Inquiry |
◆ Native Proteins | ||
POPG-42 | Active Native Pyruvate oxidase | +Inquiry |
Proteoglycans-51C | Native Chicken Proteoglycans | +Inquiry |
Neuraminidase-012C | Active Native Clostridium perfringens Phospholipase C, Type I | +Inquiry |
TF-71R | Native Rat Apotransferrin | +Inquiry |
Collagen Type I & III-04B | Native Bovine Collagen Type I and III Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FANCG-6331HCL | Recombinant Human FANCG 293 Cell Lysate | +Inquiry |
PLK1-532MCL | Recombinant Mouse PLK1 cell lysate | +Inquiry |
Adrenal-633B | Bovine Adrenal Whole Lysate, Total Protein | +Inquiry |
G6PC-6082HCL | Recombinant Human G6PC 293 Cell Lysate | +Inquiry |
ASAH2-2806MCL | Recombinant Mouse ASAH2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Rru_A2625 Products
Required fields are marked with *
My Review for All Rru_A2625 Products
Required fields are marked with *
0
Inquiry Basket