Recombinant Full Length Alpha-Hemolysin Translocation Atp-Binding Protein Hlyb(Hlyb) Protein, His-Tagged
Cat.No. : | RFL12108EF |
Product Overview : | Recombinant Full Length Alpha-hemolysin translocation ATP-binding protein HlyB(hlyB) Protein (Q47258) (1-707aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-707) |
Form : | Lyophilized powder |
AA Sequence : | MDSCHKIDYGLYALEILAQYHNVSVNPEEIKHRFDTDGTGLGLTSWLLAAKSLELKVKQV KKTIDRLNFISLPALVWREDGRHFILTKVSKEANRYLIFDLEQRNPRVLEQSEFEALYQG HIILIASRSSVAGKLAKFDFTWFIPAIIKYRRIFIETLVVSVFLQLFALITPLFFQVVMD KVLVHRGFSTLNVITVALSVVVVFEIILSGLRTYIFAHSTSRIDVELGAKLFRHLLALPI SYFESRRVGDTVARVRELDQIRNFLTGQALTSVLDLLFSFIFFAVMWYYSPKLTLVILFS LPCYAAWSVFISPILRRRLDDKFSRNADNQSFLVESVTAINTIKAMAVSPQMTNIWDKQL AGYVAAGFKVTVLATIGQQGIQLIQKTVMIINLWLGAHLVISGDLSIGQLIAFNMLAGQI VAPVIRLAQIWQDFQQVGISVTRLGDVLNSPTESYHGKLALPEINGDITFRNIRFRYKPD SPVILDNINLSIKQGEVIGIVGRSGSGKSTLTKLIQRFYIPENGQVLIDGHDLALADPNW LRRQVGVVLQDNVLLNRSIIDNISLANPGMSVEKVIYAAKLAGAHDFISELREGYNTIVG EQGAGLSGGQRQRIAIARALVNNPKILIFDEATSALDYESEHIIMRNMHKICKGRTVIII AHRLSTVKNADRIIVMEKGKIVEQGKHKELLSEPESLYSYLYQLQSD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | hlyB |
Synonyms | hlyB; Alpha-hemolysin translocation ATP-binding protein HlyB |
UniProt ID | Q47258 |
◆ Recombinant Proteins | ||
RFL32839XF | Recombinant Full Length Xanthomonas Oryzae Pv. Oryzae Prolipoprotein Diacylglyceryl Transferase(Lgt) Protein, His-Tagged | +Inquiry |
PROC-32H | Active Recombinant Human PROC Protein | +Inquiry |
Rgs19-5495M | Recombinant Mouse Rgs19 Protein, Myc/DDK-tagged | +Inquiry |
Wdr91-177M | Recombinant Mouse Wdr91 Protein, MYC/DDK-tagged | +Inquiry |
LRRC20-9256M | Recombinant Mouse LRRC20 Protein | +Inquiry |
◆ Native Proteins | ||
Adipose Tissue-001H | Human Adipose Tissue Lysate, Total Protein | +Inquiry |
Collagen-315B | Native Bovine Collagen Type III | +Inquiry |
SERPINA3-8349H | Native Human SERPINA3 | +Inquiry |
S100A1B-9H | Native Human S100A1B | +Inquiry |
IgG-150G | Native Goat IgG Fab fragment | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFI30-1503HCL | Recombinant Human IFI30 cell lysate | +Inquiry |
TELO2-1148HCL | Recombinant Human TELO2 293 Cell Lysate | +Inquiry |
STAM2-1429HCL | Recombinant Human STAM2 293 Cell Lysate | +Inquiry |
HSP90AA1-5362HCL | Recombinant Human HSP90AA1 293 Cell Lysate | +Inquiry |
NDUFB3-3906HCL | Recombinant Human NDUFB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All hlyB Products
Required fields are marked with *
My Review for All hlyB Products
Required fields are marked with *
0
Inquiry Basket