Recombinant Full Length Rhodopseudomonas Palustris Upf0283 Membrane Protein Rpa1583(Rpa1583) Protein, His-Tagged
Cat.No. : | RFL16755RF |
Product Overview : | Recombinant Full Length Rhodopseudomonas palustris UPF0283 membrane protein RPA1583(RPA1583) Protein (Q6N9G6) (1-369aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhodopseudomonas palustris |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-369) |
Form : | Lyophilized powder |
AA Sequence : | MTERVPPRRPATFKLSDPSVVLIDSDDGGGSYTAKPSAKADARPAASAAGAAPPPPPPRA RVELAREAEPPISAPKAPKSVINPKKGFRWGTVFWSAATGLVSLAFWLWISKLVEDLFAQ SQTLGTIGMVLALLAGGSLAIIIGREAFGLIRLARIEQLHARAARVLETDNSAEARAIIR ELLKFEHPNPQLAHGRATLQKHIDDIIDGADLIRLAERELMAQLDLEAKVLISKAAQRVS LVTAISPKALIDVLFVAIAATRLIGQLARLYGGRPGALGMFKLMRQTVSHLAITGGIALS DSVMQSVLGHGLASRLSAKLGEGVVNGMLTARLGLAAMDLTRPLPFDALPRPQLGDLVKD LMKKREKDE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | RPA1583 |
Synonyms | RPA1583; UPF0283 membrane protein RPA1583 |
UniProt ID | Q6N9G6 |
◆ Recombinant Proteins | ||
IDI1-26060TH | Recombinant Human IDI1, His-tagged | +Inquiry |
SULT1A1-5487R | Recombinant Rat SULT1A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
FAM192A-5560M | Recombinant Mouse FAM192A Protein | +Inquiry |
ATP6V0D1-1868H | Recombinant Human ATP6V0D1 protein, GST-tagged | +Inquiry |
FLNA-185H | Recombinant Human FLNA protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
ALPL-66C | Active Native Calf Alkaline Phosphatase | +Inquiry |
Ferrous Hemoglobin-032B | Native Bovine Ferrous Hemoglobin Protein | +Inquiry |
IgG-125G | Native Goat Immunoglobulin G | +Inquiry |
LTF-312H | Native Human LTF protein | +Inquiry |
COL1A1-23M | Native Mouse Collagen I Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
INF2-5209HCL | Recombinant Human INF2 293 Cell Lysate | +Inquiry |
CNPPD1-8086HCL | Recombinant Human C2orf24 293 Cell Lysate | +Inquiry |
FSTL3-2793MCL | Recombinant Mouse FSTL3 cell lysate | +Inquiry |
HBEGF-551HCL | Recombinant Human HBEGF cell lysate | +Inquiry |
Pancreas-802G | Guinea Pig Pancreas Membrane Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RPA1583 Products
Required fields are marked with *
My Review for All RPA1583 Products
Required fields are marked with *
0
Inquiry Basket