Recombinant Full Length Rhizobium Sp. Probable Conjugal Transfer Protein Trbd(Trbd) Protein, His-Tagged
Cat.No. : | RFL3090SF |
Product Overview : | Recombinant Full Length Rhizobium sp. Probable conjugal transfer protein trbD(trbD) Protein (P55397) (1-99aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Sinorhizobium fredii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-99) |
Form : | Lyophilized powder |
AA Sequence : | MAEALSERYRNRIHRALSRPNLLMGADRELVLITGLAAVILIFVVLTVYSALFGVVVWIV IVGLLRMMAKSDPLMRQVYVRHISYKPYYKATTSPWRRY |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | trbD |
Synonyms | trbD; NGR_a04190; y4cO; Probable conjugal transfer protein TrbD |
UniProt ID | P55397 |
◆ Native Proteins | ||
Lectin-1767D | Active Native Datura Stramonium Lectin Protein, Fluorescein labeled | +Inquiry |
ACTB-882P | Native Porcine ACTB Protein | +Inquiry |
FTH1-001H | Native Horse FTH1 Protein | +Inquiry |
ACTA1-854P | Native Porcine ACTA1 Protein | +Inquiry |
F10-26055TH | Native Human F10 | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAS-1139RCL | Recombinant Rat FAS cell lysate | +Inquiry |
PEMT-3299HCL | Recombinant Human PEMT 293 Cell Lysate | +Inquiry |
NOX1-3751HCL | Recombinant Human NOX1 293 Cell Lysate | +Inquiry |
CNTN3-1299RCL | Recombinant Rat CNTN3 cell lysate | +Inquiry |
UPK1A-723HCL | Recombinant Human UPK1A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All trbD Products
Required fields are marked with *
My Review for All trbD Products
Required fields are marked with *
0
Inquiry Basket