Recombinant Full Length Ralstonia Pickettii Atp-Dependent Zinc Metalloprotease Ftsh(Ftsh) Protein, His-Tagged
Cat.No. : | RFL18831RF |
Product Overview : | Recombinant Full Length Ralstonia pickettii ATP-dependent zinc metalloprotease FtsH(ftsH) Protein (B2UE66) (1-714aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Ralstonia pickettii |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-714) |
Form : | Lyophilized powder |
AA Sequence : | MEKPRRLRPRARPQCRGLMKVNLGDFQASILGTHTNARLSGAYPGRPPTFPALETRLTFN KVDLEKNPMEPRQQQFSLWYVLVTILAMLAIQTLFVSGHVETIPYSDFKVLLKAGKLKDV AIGEQAISGTFSTEGIDNLLAKQQIEEIRREAKGDHAFSTLRVADPELVQELEAAKVRFV GQPDNKWLSTILSWVVPAVIFFGIWSFLIKRVGGAAGSMMEIGKSKAKVYMQKETGVTFA DVAGIDEAKEELSEIVSFLKDPQRYQRLGGKIPKGVLLVGAPGTGKTLLAKAVAGEAGVP FFSMSGSDFVEMFVGVGAARVRDLFKQAETKAPCIIFIDELDALGKTRALNAVGGNEERE QTLNQLLVEMDGFDSNKGVIIMAATNRPEILDPALLRPGRFDRHVALDRPDLKGREQILK VHVKGVVLAPEVDLTKLAGRTPGFAGADLANLVNEAALLAARKSKQMVEMADFDEALDRI VGGLEKKNRVMNPKEKETIAFHEAGHAIVAEHRPLADRVSKVSIIPRGVAALGYTQQTPT EDRYLLKRSELLDRLDVLLGGRIAEQLIFGDVSTGAQNDLQRATDMARQMITQFGMSDQL GLATYENMPNPLFAGTGLMQRERNEYSESTAQMIDAEVRKLLAEASHRVQATLEGQRTKL DALAQLLLEKEVVDRQDLDMFLSAKVTPMPPPKPVANIEESTATGKPDQKTQGT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ftsH |
Synonyms | ftsH; Rpic_1702; ATP-dependent zinc metalloprotease FtsH |
UniProt ID | B2UE66 |
◆ Recombinant Proteins | ||
peptidase M60 viral enhancin protein-5715S | Recombinant Serratia marcescens peptidase M60 viral enhancin Protein (Pro2-Asp855), C-His tagged | +Inquiry |
RFL34332MF | Recombinant Full Length Mouse Probable Polyprenol Reductase(Srd5A3) Protein, His-Tagged | +Inquiry |
RFL1983TF | Recombinant Full Length Thermotoga Maritima Uncharacterized Protein Tm_0562.1 (Tm_0562.1) Protein, His-Tagged | +Inquiry |
CXCL8-1058C | Recombinant Cattle CXCL8 Protein, His-tagged | +Inquiry |
RNASEL-2925C | Recombinant Chicken RNASEL | +Inquiry |
|
◆ Native Proteins | ||
TF-8273H | Native Human Serum Transferrin HOLO(iron-saturated) | +Inquiry |
TTR-254H | Native Human Prealbumin | +Inquiry |
HDL-1539HB | Native Human High-density lipoprotein, Biotinylated | +Inquiry |
IGHA-209H | Native Human Immunoglobulin A (IgA) | +Inquiry |
APOC3-27333TH | Native Human APOC3 | +Inquiry |
◆ Cell & Tissue Lysates | ||
PFDN5-3278HCL | Recombinant Human PFDN5 293 Cell Lysate | +Inquiry |
SERPINF2-2445HCL | Recombinant Human SERPINF2 cell lysate | +Inquiry |
SCAMP5-576HCL | Recombinant Human SCAMP5 lysate | +Inquiry |
CRISP1-400HCL | Recombinant Human CRISP1 cell lysate | +Inquiry |
Duodenum-110H | Human Duodenum Liver Cirrhosis Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ftsH Products
Required fields are marked with *
My Review for All ftsH Products
Required fields are marked with *
0
Inquiry Basket