Recombinant Full Length Rhizobium Leguminosarum Bv. Viciae Beta-(1-->2)Glucan Export Atp-Binding/Permease Protein Ndva(Ndva) Protein, His-Tagged
Cat.No. : | RFL21345RF |
Product Overview : | Recombinant Full Length Rhizobium leguminosarum bv. viciae Beta-(1-->2)glucan export ATP-binding/permease protein NdvA(ndvA) Protein (Q1MAB5) (1-587aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rhizobium leguminosarum bv. viciae |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-587) |
Form : | Lyophilized powder |
AA Sequence : | MTLFKVYARALRYLGAYKLRVSLVVVANIVLATITIAEPILFGRIIDAISGKGEVKPILF MWATFAVFNTIAFVLVAREADRLAHGRRATLLTEAFGRIISMPLGWHHQRGTSNALHTLL RACETLFGLWLEFMRNHLSTVIALALLIPTAMSMDLRLSAVLMVLAIAYWLIGRVVMSRT KDGQASVENHYHTVFSHVSDSISNVSVLHSYNRIEAETRALKSFADRLLEAQYPVLDWWA IASALNRMASTIAMMVVLIIGTMLVQAGQLRVGDVIAFIGFANLLIGRLDLMRQFATQIF EARSKLEEFYALEDSVREREEPAGNGEIKDVKGAIEFRDVSFGFGNSSQGLHNVSFSVKA GQTVAIVGPTGAGKTTLVNLLQRVYDAQGGKILVDGTDITKVTRKSLRRHIATVFQDAGL LNRSISDNIRLGREGASEEEMRRAAEAAAAADFIETREDRYDTHVGERGNKLSGGERQRI AIARAILKDAPILVLDEATSALDVETEARVKAAIDNLRQNRTTFIIAHRLSTVREADMVL FLDDGRVVEQGSFDELSHSNGRFAALLRASGILTDEEVRKAHTTEAA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ndvA |
Synonyms | ndvA; RL4640; Beta-(1-->2glucan export ATP-binding/permease protein NdvA |
UniProt ID | Q1MAB5 |
◆ Recombinant Proteins | ||
GNAI3-2707H | Recombinant Human GNAI3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
VCAM1-71HA | Active Recombinant Human VCAM1 protein, Fc-tagged, APC labeled | +Inquiry |
TPSB2-3378H | Recombinant Human TPSB2, His-tagged | +Inquiry |
RFL35462CF | Recombinant Full Length Caulobacter Crescentus Metalloprotease Mmpa(Mmpa) Protein, His-Tagged | +Inquiry |
Lsp1-1343M | Recombinant Mouse Lsp1 Protein, MYC/DDK-tagged | +Inquiry |
◆ Native Proteins | ||
IgA-243C | Native Cat Immunoglobulin A | +Inquiry |
LYZ-5316H | Native Human Lysozyme(salivary) | +Inquiry |
A2m-695R | Native Rat Alpha-2-Macroglobulin | +Inquiry |
F12-13H | Native Human Factor beta-XIIa, Biotin Labeled | +Inquiry |
FSH-185H | Active Native Human Follicle Stimulating Hormone(FSH) protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC39A2-1721HCL | Recombinant Human SLC39A2 293 Cell Lysate | +Inquiry |
LPPR1-4663HCL | Recombinant Human LPPR1 293 Cell Lysate | +Inquiry |
RAB7B-2582HCL | Recombinant Human RAB7B 293 Cell Lysate | +Inquiry |
LOC81691-4680HCL | Recombinant Human LOC81691 293 Cell Lysate | +Inquiry |
PLK5-487HCL | Recombinant Human PLK5 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ndvA Products
Required fields are marked with *
My Review for All ndvA Products
Required fields are marked with *
0
Inquiry Basket