Recombinant Full Length Caulobacter Crescentus Metalloprotease Mmpa(Mmpa) Protein, His-Tagged
Cat.No. : | RFL35462CF |
Product Overview : | Recombinant Full Length Caulobacter crescentus Metalloprotease mmpA(mmpA) Protein (Q9A710) (1-398aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caulobacter crescentus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-398) |
Form : | Lyophilized powder |
AA Sequence : | MIGFLIMLVSLLFVLSVVVTVHELGHYWAARACGVAIERFSIGFGAPLISWRDKRGVEWC VASIPLGGYVRFAGDENAASVPDQNDLDAMRNEIRRREGDDAVNRYFHFKPVWQRAFIAV AGPMANFILAILVFAVILVSFGAQKTSTTVGEVVAGTPAAAAGFKPGDVILKADNRQIRS FQDIQGYVALRANMPIDFAVERDGRTVHLTATPRLVERQNEISGRVKVGELGLRSAPGGR FERSSLLSAIPDATVEVWDMIKTIAFYLGRLLMGQLPADQISGIIGIGHTAGAVTNGVVE QAPNGKALAIGLIYSQFWLIASLSVSIGFMNLLPIPVLDGGHLVMYAYEAVAKRPLRAEF QAAGFRAGLALILGFMLFAAWNDLNRYDVFKFIGGLFT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | mmpA |
Synonyms | mmpA; CC_1916; Metalloprotease MmpA; Membrane metalloprotease A |
UniProt ID | Q9A710 |
◆ Recombinant Proteins | ||
POLR2C-7633Z | Recombinant Zebrafish POLR2C | +Inquiry |
Dct-2479M | Recombinant Mouse Dct Protein, Myc/DDK-tagged | +Inquiry |
AK5-1348H | Recombinant Human Adenylate Kinase 5, His-tagged | +Inquiry |
TTR-1438Z | Recombinant Zebrafish TTR | +Inquiry |
YWDE-3341B | Recombinant Bacillus subtilis YWDE protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
Pancreas-002H | Human Pancreas Lysate, Total Protein | +Inquiry |
dsbA-8328E | Native E.coli dsbA | +Inquiry |
GFAP-526H | Native Human GFAP protein | +Inquiry |
TFRC-69H | Native Human Apotransferrin | +Inquiry |
Fgg -65R | Native Rat Fibrinogen, FITC Labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
NFYB-3839HCL | Recombinant Human NFYB 293 Cell Lysate | +Inquiry |
CD63-001RCL | Recombinant Rat CD63 cell lysate | +Inquiry |
PRKACB-2868HCL | Recombinant Human PRKACB 293 Cell Lysate | +Inquiry |
KANSL3-4965HCL | Recombinant Human KIAA1310 293 Cell Lysate | +Inquiry |
GMCL1P1-718HCL | Recombinant Human GMCL1P1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All mmpA Products
Required fields are marked with *
My Review for All mmpA Products
Required fields are marked with *
0
Inquiry Basket