Recombinant Full Length Respiratory Nitrate Reductase 2 Gamma Chain(Narv) Protein, His-Tagged
Cat.No. : | RFL22185EF |
Product Overview : | Recombinant Full Length Respiratory nitrate reductase 2 gamma chain(narV) Protein (P0AF33) (1-226aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | E.coli |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-226) |
Form : | Lyophilized powder |
AA Sequence : | MIQYLNVFFYDIYPYICATVFFLGSWLRYDYGQYTWRASSSQMLDKRGMVIWSNLFHIGI LGIFFGHLFGMLTPHWMYAWFLPVAAKQLMAMVLGGICGVLTLIGGAGLLWRRLTNQRVR ATSTTPDIIIMSILLIQCLLGLSTIPFSAQYPDGSEMMKLVGWAQSIVTFRGGSSEMLNG VAFVFRLHLVLGMTIFLLFPFTRLVHVWSAPFEYFTRRYQIVRSRR |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | narV |
Synonyms | narV; Z2247; ECs2068; Respiratory nitrate reductase 2 gamma chain |
UniProt ID | P0AF33 |
◆ Native Proteins | ||
CTSD-26411TH | Active Native Human Cathepsin D protein | +Inquiry |
IgG-356B | Native Bovine Gamma Globulin Fraction | +Inquiry |
PNLIP-1175P | Native Porcine Pancreatic Lipase | +Inquiry |
GG-191P | Native Porcine Gamma Globulin protein | +Inquiry |
Fibrinogen-01S | Native Atlantic salmon Fibrinogen | +Inquiry |
◆ Cell & Tissue Lysates | ||
C3P1-1010HCL | Recombinant Human C3P1 cell lysate | +Inquiry |
Brain-40H | Human Brain Liver Cirrhosis Lysate | +Inquiry |
HA-2544HCL | Recombinant H5N1 HA cell lysate | +Inquiry |
CD38-1557HCL | Recombinant Human CD38 cell lysate | +Inquiry |
Skin-445R | Rhesus monkey Skin Membrane Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All narV Products
Required fields are marked with *
My Review for All narV Products
Required fields are marked with *
0
Inquiry Basket