Recombinant Full Length Rat Transmembrane Protein 194B(Tmem194B) Protein, His-Tagged
Cat.No. : | RFL13042RF |
Product Overview : | Recombinant Full Length Rat Transmembrane protein 194B(Tmem194b) Protein (P0C8N6) (1-421aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-421) |
Form : | Lyophilized powder |
AA Sequence : | MPPGSWWLVLWLPPLATLPAGAVPQEEAAMSVPRCKSLKETDLIKTSVSDCYCYNQHSQI EWTYMWSTVQVTVTSPGLLSIVYITGRHTCQHTETILSFLKCVTHNFWTAEEAKEVTIVF SPYGETVCFSVKPVGSLLTYAVSVNRNVVDFRLFLVFATGIFLFFYAKTLSQSPVFYYSS GTVLGILMTLVFVLLMTKKHIPKYSTFGALMIGCWFASVYVLCQLMENLKWLWCGNRIYV LGYVLVVGLCSFSACYSRGPPADEGSRDLLMWALRFLSLVLVYTGMAISQFAYAVMILLL LSWTRHYLLRAFSCLRWKVRQWFATRALVVRYLTDDEYREQAEAETASALEELRQACCRP DFPSWLAVSRLQAPKKFAEFVLGASHLSPEEVSTHEKQYGLGGAFLEEQLFSLQTESLPA S |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Nemp2 |
Synonyms | Nemp2; Tmem194b; Nuclear envelope integral membrane protein 2 |
UniProt ID | P0C8N6 |
◆ Recombinant Proteins | ||
Atp5i-3716R | Recombinant Rat Atp5i, GST-tagged | +Inquiry |
GPHN-1009H | Recombinant Human GPHN Protein, His (Fc)-Avi-tagged | +Inquiry |
PPP2CB-650H | Recombinant Human PPP2CB Protein, His-tagged | +Inquiry |
ZRANB1-3700H | Recombinant Human ZRANB1 protein, His-tagged | +Inquiry |
SUB1A-8360Z | Recombinant Zebrafish SUB1A | +Inquiry |
◆ Native Proteins | ||
Collagen Type I-09B | Native Bovine Collagen Type I Protein | +Inquiry |
C5b6-1537H | Active Native Human C5b,6 Complex Protein | +Inquiry |
Glycogen-016B | Native bovine liver Glycogen | +Inquiry |
IgG-169H | Native Human IgG Fc fragment | +Inquiry |
CMA1-35H | Active Native Human CMA1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ZNF84-1HCL | Recombinant Human ZNF84 293 Cell Lysate | +Inquiry |
ARHGEF9-8728HCL | Recombinant Human ARHGEF9 293 Cell Lysate | +Inquiry |
ZNF362-87HCL | Recombinant Human ZNF362 293 Cell Lysate | +Inquiry |
TCTEX1D2-1161HCL | Recombinant Human TCTEX1D2 293 Cell Lysate | +Inquiry |
Persimmon-704P | Persimmon Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Nemp2 Products
Required fields are marked with *
My Review for All Nemp2 Products
Required fields are marked with *
0
Inquiry Basket