Recombinant Human ZRANB1 protein, His-tagged
Cat.No. : | ZRANB1-3700H |
Product Overview : | Recombinant Human ZRANB1 protein(1-100 aa), fused to His tag, was expressed in E. coli. |
Availability | April 15, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-100 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | MSERGIKWACEYCTYENWPSAIKCTMCRAQRPSGTIITEDPFKSGSSDVGRDWDPSSTEGGSSPLICPDSSARPRVKSSYSMENANKWSCHMCTYLNWPR |
Purity : | 98%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ZRANB1 zinc finger, RAN-binding domain containing 1 [ Homo sapiens ] |
Official Symbol | ZRANB1 |
Synonyms | ZRANB1; zinc finger, RAN-binding domain containing 1; ubiquitin thioesterase ZRANB1; TRABID; hTrabid; TRAF-binding protein domain; TRAF-binding domain-containing protein; zinc finger Ran-binding domain-containing protein 1; DKFZp762P2216; |
Gene ID | 54764 |
mRNA Refseq | NM_017580 |
Protein Refseq | NP_060050 |
MIM | 611749 |
UniProt ID | Q9UGI0 |
◆ Recombinant Proteins | ||
ZRANB1-6422H | Recombinant Human ZRANB1 protein, His&Myc-tagged | +Inquiry |
ZRANB1-3700H | Recombinant Human ZRANB1 protein, His-tagged | +Inquiry |
ZRANB1-19230M | Recombinant Mouse ZRANB1 Protein | +Inquiry |
ZRANB1-1237H | Recombinant Human ZRANB1 protein, His&GST-tagged | +Inquiry |
ZRANB1-158H | Active Recombinant Human ZRANB1, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ZRANB1 Products
Required fields are marked with *
My Review for All ZRANB1 Products
Required fields are marked with *
0
Inquiry Basket