Recombinant Full Length Rat Sterol-4-Alpha-Carboxylate 3-Dehydrogenase, Decarboxylating(Nsdhl) Protein, His-Tagged
Cat.No. : | RFL4641RF |
Product Overview : | Recombinant Full Length Rat Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating(Nsdhl) Protein (Q5PPL3) (1-362aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-362) |
Form : | Lyophilized powder |
AA Sequence : | MEQAVRSESKKGQVTGTDLINEVSKAKKCTVIGGSGFLGQHMVEQLLSRGYAVNVFDVRQ GFDNPRVQFFIGDLCNQQDLYPALKGVSTVFHCASPPSNSNNKELFYRVNSTGTKTVIET CKEAGVQKLILTSSASVVFEGVDIKNGTEDLPYAMKPIDYYTETKILQERAVLDANDPKK NFLTAAIRPHGIFGPRDPQLVPVLIDAARKGKMKFMIGNGKNLVDFTFVENVVHGHILAA EHLSRDAGLGGKAFHITNDEPIPFWTFLSRILTGLNYEAPKYHIPYRVAYYLAFLLSLLV MVLSPLIQIQTTFTPFRVALAGTFHYYSCEKAKKLIGYRPLVTMDDAVERTVQSFHHLRK DK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Nsdhl |
Synonyms | Nsdhl; Sterol-4-alpha-carboxylate 3-dehydrogenase, decarboxylating |
UniProt ID | Q5PPL3 |
◆ Recombinant Proteins | ||
MUCL1-1870H | Recombinant Human MUCL1 protein, His & GST-tagged | +Inquiry |
LECT1-6748Z | Recombinant Zebrafish LECT1 | +Inquiry |
Cyp11b1-8080R | Recombinant Rat Cyp11b1 protein, His & T7-tagged | +Inquiry |
SPRR4-2731H | Recombinant Human SPRR4 Protein, His-tagged | +Inquiry |
ELF5-1263R | Recombinant Rhesus Macaque ELF5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
Clostripain-02C | Native Clostridium histolyticum Clostripain, Sequencing Grade | +Inquiry |
APOA1-8034H | Native Human ApoLipoprotein | +Inquiry |
LDH-121B | Active Native Bovine Lactate Dehydrogenase | +Inquiry |
MBP-99S | Native Swine MBP | +Inquiry |
IGHD -20H | Native Human IgD | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN6-7460HCL | Recombinant Human CLDN6 293 Cell Lysate | +Inquiry |
CLDN11-1288HCL | Recombinant Human CLDN11 cell lysate | +Inquiry |
METTL4-4356HCL | Recombinant Human METTL4 293 Cell Lysate | +Inquiry |
SAMD12-2073HCL | Recombinant Human SAMD12 293 Cell Lysate | +Inquiry |
BCDIN3D-8494HCL | Recombinant Human BCDIN3D 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Nsdhl Products
Required fields are marked with *
My Review for All Nsdhl Products
Required fields are marked with *
0
Inquiry Basket