Recombinant Full Length Rat Protein Yipf3(Yipf3) Protein, His-Tagged
Cat.No. : | RFL26403RF |
Product Overview : | Recombinant Full Length Rat Protein YIPF3(Yipf3) Protein (Q6TUD4) (1-347aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-347) |
Form : | Lyophilized powder |
AA Sequence : | MATQAAPASGVRNGAGPEWGGFEENIQGGGSAVIDMENMDDTSGSSFEDMGELHQRLREE EVDADAAAAEEEDGEFLGMKGFKGQLSRQVADQMWQAGKRQASKAFSLYANIDILRPYFD VEPAQVRSRLLESMIPIKMVNFPQKVAGELYGPLMLVFTLVAILLHGMKTSDTIIREGTL MGTAIGTCFGYWLGVSSFIYFLAYLCNAQITMLQMLALLGYGLFGHCIVLFITYNIHLHA LFYLFWLLLGGLSTLRMVAVLVSRTVGPTQRLLLCGTLAALHMLFLLYLHFAYHKVVEGI LDTLEGPNIPPMQRVPRDIPAVLPAAKLPVAVVNATAKAIAVTLQSH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Yipf3 |
Synonyms | Yipf3; Protein YIPF3; Liver regeneration-related protein LRRGT00110; YIP1 family member 3 |
UniProt ID | Q6TUD4 |
◆ Recombinant Proteins | ||
RFL4401MF | Recombinant Full Length Mouse Protein Yipf3(Yipf3) Protein, His-Tagged | +Inquiry |
YIPF3-5238R | Recombinant Rhesus monkey YIPF3 Protein, His-tagged | +Inquiry |
YIPF3-10276Z | Recombinant Zebrafish YIPF3 | +Inquiry |
RFL26403RF | Recombinant Full Length Rat Protein Yipf3(Yipf3) Protein, His-Tagged | +Inquiry |
RFL19998GF | Recombinant Full Length Chicken Protein Yipf3(Yipf3) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
YIPF3-245HCL | Recombinant Human YIPF3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Yipf3 Products
Required fields are marked with *
My Review for All Yipf3 Products
Required fields are marked with *
0
Inquiry Basket