Recombinant Full Length Rat Probable G-Protein Coupled Receptor 160(Gpr160) Protein, His-Tagged
Cat.No. : | RFL6342RF |
Product Overview : | Recombinant Full Length Rat Probable G-protein coupled receptor 160(Gpr160) Protein (Q66H29) (1-336aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-336) |
Form : | Lyophilized powder |
AA Sequence : | MTALPSKNCSFQYQSHQAPRSLDATCLLLLIILGKVLLNVLILRVKRKDTSWSFMEYFCF SLALVDLLLLVNISVLTYFRDFVVLGIRFTNYHICLLTQIVSFAYGFLHYPVCSLACIDY WCNLSRATKPSSRWQKLLYLLTVILTWISVLAYVLGDPAISASLKTHKTSVNQCPSYVST QSHWLSLSMLMILSVAFLISWQEVVALIQAIRIASYKNKAVLYFPFPPHTSYTVSPRAVL LPRLIVCFLGTWFPFVALQVLILSLRVQIPAYIEMNVPWLYFVNSFLIAAVYWFNCHKLY WRDGMFPVDPFINWKCCFVPVHRLKQVERPMSIIIC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gpr160 |
Synonyms | Gpr160; Probable G-protein coupled receptor 160 |
UniProt ID | Q66H29 |
◆ Recombinant Proteins | ||
RAB39B-2118H | Recombinant Human RAB39B, GST-tagged | +Inquiry |
PCDH2AB7-1963Z | Recombinant Zebrafish PCDH2AB7 | +Inquiry |
RPS6-14492M | Recombinant Mouse RPS6 Protein | +Inquiry |
BLOC1S4-2421M | Recombinant Mouse BLOC1S4 Protein | +Inquiry |
ERG-1906Z | Recombinant Zebrafish ERG | +Inquiry |
◆ Native Proteins | ||
COL1-119H | Native Human COL1 protein, Biotinylated | +Inquiry |
ALB-20H | Native Human Serum Albumin Protein | +Inquiry |
C3a-08H | Native Human Complement C3 alpha protein | +Inquiry |
GOT1-01H | Active Native Human GOT1 Protein | +Inquiry |
FSH-1564H | Active Native Human Follicle Stimulating Hormone | +Inquiry |
◆ Cell & Tissue Lysates | ||
ATG5-8622HCL | Recombinant Human ATG5 293 Cell Lysate | +Inquiry |
C1orf50-8157HCL | Recombinant Human C1orf50 293 Cell Lysate | +Inquiry |
ADCK5-11HCL | Recombinant Human ADCK5 lysate | +Inquiry |
SLX1B-5924HCL | Recombinant Human GIYD2 293 Cell Lysate | +Inquiry |
Colon-780D | Dog Colon Membrane Lysate, Total Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gpr160 Products
Required fields are marked with *
My Review for All Gpr160 Products
Required fields are marked with *
0
Inquiry Basket