Recombinant Full Length Mouse Probable G-Protein Coupled Receptor 160(Gpr160) Protein, His-Tagged
Cat.No. : | RFL23696MF |
Product Overview : | Recombinant Full Length Mouse Probable G-protein coupled receptor 160(Gpr160) Protein (Q3U3F9) (1-336aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-336) |
Form : | Lyophilized powder |
AA Sequence : | MTALSSKNCSLQYQLHQSPQLLEASCLLFLIILGKVLLNILLLRVRRGDARWTLMEYFCF SLALVDLLLLVNISILTYFRDFVVLGIRFTRYHICLLTQIISFTYGFLHYPVCSLACIDY WCNLSRASKQSSRWQKLLYFLTVILTWISVLAYVLVDPAISVSLKAHRGYVYQCPAYVST QSHWLSLSMLMVLFVAFLISWQEVVALLQAMRIASYKSKAALYFPFPLHCGYALSCREAL LPRLIVCFLGTWFPFVALQVLILSLRVQIPAYIEMNVPWLYFVNSFLIAAVYWFNCHKLD LRDSSLPVDPFINWKCCFVPVHRLKQVERPMSIVIC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gpr160 |
Synonyms | Gpr160; Probable G-protein coupled receptor 160 |
UniProt ID | Q3U3F9 |
◆ Recombinant Proteins | ||
ENO1-30HFL | Recombinant Full Length Human ENO1 Protein, C-Flag-tagged | +Inquiry |
PLEKHH3-12962M | Recombinant Mouse PLEKHH3 Protein | +Inquiry |
TGFBR1-1495H | Active Recombinant Human TGFBR1, GST-tagged | +Inquiry |
Anxa2-7844M | Recombinant Mouse Anxa2 protein, His-tagged | +Inquiry |
INHBB-138H | Recombinant Human INHBB, Animal Free | +Inquiry |
◆ Native Proteins | ||
Complement C1q-43H | Native Human Complement C1q | +Inquiry |
SUMO Protease-02 | Native purified SUMO Protease, His-tagged | +Inquiry |
FGA-34D | Native Canine Fibrinogen | +Inquiry |
TNNI3-221H | Native Human TNNI3 | +Inquiry |
ALPL-25H | Active Native Human ALPL Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
BDH1-168HCL | Recombinant Human BDH1 cell lysate | +Inquiry |
ZNF750-15HCL | Recombinant Human ZNF750 293 Cell Lysate | +Inquiry |
HSPA2-5355HCL | Recombinant Human HSPA2 293 Cell Lysate | +Inquiry |
CCDC85B-161HCL | Recombinant Human CCDC85B lysate | +Inquiry |
ARL4C-8712HCL | Recombinant Human ARL4C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Gpr160 Products
Required fields are marked with *
My Review for All Gpr160 Products
Required fields are marked with *
0
Inquiry Basket