Recombinant Full Length Rat Potassium Voltage-Gated Channel Subfamily C Member 4(Kcnc4) Protein, His-Tagged
Cat.No. : | RFL12688RF |
Product Overview : | Recombinant Full Length Rat Potassium voltage-gated channel subfamily C member 4(Kcnc4) Protein (Q63734) (1-625aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-625) |
Form : | Lyophilized powder |
AA Sequence : | MISSVCVSSYRGRKSGNKPPSKTCLKEEMAKGEASEKIIINVGGTRHETYRSTLRTLPGT RLAWLADPDGGGRPESDGGGAGSSGSSGGGGGCEFFFDRHPGVFAYVLNYYRTGKLHCPA DVCGPLFEEELTFWGIDETDVEPCCWMTYRQHRDAEEALDIFESPDGGGGGAGPGDEAGD DERELALQRLGPHEGGSGPGAGSGGCRGWQPRMWALFEDPYSSRAARVVAFASLFFILVS ITTFCLETHEAFNIDRNVTEIHRVGNITSVRFRREVETEPILTYIEGVCVMWFTLEFLVR IVCCPDTLDFVKNLLNIIDFVAILPFYLEVGLSGLSSKAARDVLGFLRVVRFVRILRIFK LTRHFVGLRVLGHTLRASTNEFLLLIIFLALGVLIFATMIYYAERIGARPSDPRGNDHTD FKNIPIGFWWAVVTMTTLGYGDMYPKTWSGMLVGALCALAGVLTIAMPVPVIVNNFGMYY SLAMAKQKLPKKRKKHVPRPPQLESPIYCKSEETSPRDSTYSDTSPPAREEGMVERKRAD SKQNGDANAVLSDEEGAGLTQPLASAPTPEERRALRRSGTRDRNKKAAACFLLSAGDYAC ADGSVQKEGSVEPKACVPVSHTCAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Kcnc4 |
Synonyms | Kcnc4; Potassium voltage-gated channel subfamily C member 4; Raw3; Voltage-gated potassium channel subunit Kv3.4 |
UniProt ID | Q63734 |
◆ Recombinant Proteins | ||
RFL28553HF | Recombinant Full Length Human Adp/Atp Translocase 4(Slc25A31) Protein, His-Tagged | +Inquiry |
MSRB1-5752M | Recombinant Mouse MSRB1 Protein, His (Fc)-Avi-tagged | +Inquiry |
VCPIP1-17H | Recombinant Human VCPIP1 Protein, N-GST-tagged | +Inquiry |
RFL16300SF | Recombinant Full Length Salmonella Agona Phosphoglycerol Transferase I(Mdob) Protein, His-Tagged | +Inquiry |
EHMT1-27743TH | Recombinant Human EHMT1, His-tagged | +Inquiry |
◆ Native Proteins | ||
PRTN3-243H | Native Human PRTN3 Protein | +Inquiry |
CGA-1855H | Native Human, Glycoprotein Hormones, Alpha Polypeptide | +Inquiry |
VLDL-252H | Native Human Very Low Density Lipoprotein | +Inquiry |
CDA002 | Active Native Human MUC16 Protein | +Inquiry |
Lectin-1867W | Active Native Succinylated Wheat Germ Agglutinin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ACSBG2-18HCL | Recombinant Human ACSBG2 cell lysate | +Inquiry |
NUDT16L1-3650HCL | Recombinant Human NUDT16L1 293 Cell Lysate | +Inquiry |
TRHDE-800HCL | Recombinant Human TRHDE 293 Cell Lysate | +Inquiry |
KRBOX4-30HCL | Recombinant Human ZNF673 293 Cell Lysate | +Inquiry |
NFIL3-1189HCL | Recombinant Human NFIL3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Kcnc4 Products
Required fields are marked with *
My Review for All Kcnc4 Products
Required fields are marked with *
0
Inquiry Basket