Recombinant Full Length Rat Phosphatidate Cytidylyltransferase 2(Cds2) Protein, His-Tagged
Cat.No. : | RFL3274RF |
Product Overview : | Recombinant Full Length Rat Phosphatidate cytidylyltransferase 2(Cds2) Protein (Q91XU8) (1-443aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-443) |
Form : | Lyophilized powder |
AA Sequence : | MTELRQRAVREDAPPEDKESESEAKLDGETASDSESRAETAPPPTSIDDTPEVLNRALSN LSSRWKNWWVRGILTMAMIAFFFIIIYLGPMVLMMIVMCVQIKCFHEIITIGYNVYHSYD LPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFTLYLTGFCMF VLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYM FGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSFT VDCEPSDLFRLQEYNIPGVIQSLVGWKTMRMYPFQIHSALSTFASLIGPFGGFFASGFKR AFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQQL HIFNTLKSHLTDKGILMSALEEE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cds2 |
Synonyms | Cds2; Phosphatidate cytidylyltransferase 2; CDP-DAG synthase 2; CDP-DG synthase 2; CDP-diacylglycerol synthase 2; CDS 2; CDP-diglyceride pyrophosphorylase 2; CDP-diglyceride synthase 2; CTP:phosphatidate cytidylyltransferase 2 |
UniProt ID | Q91XU8 |
◆ Recombinant Proteins | ||
CDS2-3617H | Recombinant Human CDS2 protein, His-tagged | +Inquiry |
CDS2-1077H | Recombinant Human CDS2 Protein, GST-Tagged | +Inquiry |
RFL453MF | Recombinant Full Length Mouse Phosphatidate Cytidylyltransferase 2(Cds2) Protein, His-Tagged | +Inquiry |
RFL29504HF | Recombinant Full Length Human Phosphatidate Cytidylyltransferase 2(Cds2) Protein, His-Tagged | +Inquiry |
CDS2-11071H | Recombinant Human CDS2, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cds2 Products
Required fields are marked with *
My Review for All Cds2 Products
Required fields are marked with *
0
Inquiry Basket