Recombinant Human CDS2 Protein, GST-Tagged
Cat.No. : | CDS2-1077H |
Product Overview : | Human CDS2 full-length ORF (NP_003809.1, 1 a.a. - 445 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Breakdown products of phosphoinositides are ubiquitous second messengers that function downstream of many G protein-coupled receptors and tyrosine kinases regulating cell growth, calcium metabolism, and protein kinase C activity. This gene encodes an enzyme which regulates the amount of phosphatidylinositol available for signaling by catalyzing the conversion of phosphatidic acid to CDP-diacylglycerol. This enzyme is an integral membrane protein localized to two subcellular domains, the matrix side of the inner mitochondrial membrane where it is thought to be involved in the synthesis of phosphatidylglycerol and cardiolipin and the cytoplasmic side of the endoplasmic reticulum where it functions in phosphatidylinositol biosynthesis. Two genes encoding this enzyme have been identified in humans, one mapping to human chromosome 4q21 and a second to 20p13. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 77.8 kDa |
AA Sequence : | MTELRQRVAHEPVAPPEDKESESEAKVDGETASDSESRAESAPLPVSADDTPEVLNRALSNLSSRWKNWWVRGILTLAMIAFFFIIIYLGPMVLMIIVMCVQIKCFHEIITIGYNVYHSYDLPWFRTLSWYFLLCVNYFFYGETVTDYFFTLVQREEPLRILSKYHRFISFTLYLIGFCMFVLSLVKKHYRLQFYMFGWTHVTLLIVVTQSHLVIHNLFEGMIWFIVPISCVICNDIMAYMFGFFFGRTPLIKLSPKKTWEGFIGGFFATVVFGLLLSYVMSGYRCFVCPVEYNNDTNSFTVDCEPSDLFRLQEYNIPGVIQSVIGWKTVRMYPFQIHSIALSTFASLIGPFGGFFASGFKRAFKIKDFANTIPGHGGIMDRFDCQYLMATFVNVYIASFIRGPNPSKLIQQFLTLRPDQQLHIFNTLRSHLIDKGMLTSTTEDE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CDS2 CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2 [ Homo sapiens ] |
Official Symbol | CDS2 |
Synonyms | CDS2; CDP-diacylglycerol synthase (phosphatidate cytidylyltransferase) 2; phosphatidate cytidylyltransferase 2; CDS 2; CDP-DG synthase 2; CDP-DAG synthase 2; CDP-DG synthetase 2; CDP-diglyceride synthase 2; CDP-diglyceride synthetase 2; CDP-diacylglycerol synthase 2; CDP-diglyceride diphosphorylase 2; CDP-diglyceride pyrophosphorylase 2; CTP:phosphatidate cytidylyltransferase 2; FLJ12936; FLJ38111; FLJ41837; |
Gene ID | 8760 |
mRNA Refseq | NM_003818 |
Protein Refseq | NP_003809 |
MIM | 603549 |
UniProt ID | O95674 |
◆ Recombinant Proteins | ||
CDS2-1320R | Recombinant Rat CDS2 Protein | +Inquiry |
RFL16834BF | Recombinant Full Length Bovine Phosphatidate Cytidylyltransferase 2(Cds2) Protein, His-Tagged | +Inquiry |
CDS2-3617H | Recombinant Human CDS2 protein, His-tagged | +Inquiry |
RFL3274RF | Recombinant Full Length Rat Phosphatidate Cytidylyltransferase 2(Cds2) Protein, His-Tagged | +Inquiry |
CDS2-11403Z | Recombinant Zebrafish CDS2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CDS2 Products
Required fields are marked with *
My Review for All CDS2 Products
Required fields are marked with *
0
Inquiry Basket