Recombinant Full Length Rat Neuromedin-U Receptor 1(Nmur1) Protein, His-Tagged
Cat.No. : | RFL1908RF |
Product Overview : | Recombinant Full Length Rat Neuromedin-U receptor 1(Nmur1) Protein (Q9JJI5) (1-412aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-412) |
Form : | Lyophilized powder |
AA Sequence : | MLSPNASTGLLSCNDSEFKEHFDLEDLNLTHEDLRLKYLGPQQVKQFLPICVTYLLIFVV GTLGNGLTCTVILRQKAMHTPTNFYLFSLAVSDLLVLLVGLPLELYEMQHNYPFQLGAGG CYFRILLLETVCLASVLNVTALSVERYVAVVHPLQAKSVMTRTHVRRMLGAIWVFAILFS LPNTSLHGLSPLYVPCRGPVPDSVTCTLVRPQFFYKLVIQTTILLFFCLPMVTISVLYLL IGLRLRRERMLLQEEVKGRISAAARQASHRSIQLRDRERRQVTKMLIALVIVFGTCWVPF HADRLMWSMVSHWTDGLRLAFQSVHLASGVFLYLGSAANPELYNLMSTRFRESFRETLGL GTRCCHRHQPRHDSHSHLRLTTVSTLCDRNSRDVPLAENRDPGCEQETDPPE |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Nmur1 |
Synonyms | Nmur1; Gpr66; Neuromedin-U receptor 1; NMU-R1; G-protein coupled receptor 66; G-protein coupled receptor FM-3 |
UniProt ID | Q9JJI5 |
◆ Recombinant Proteins | ||
SLC52A3-15477M | Recombinant Mouse SLC52A3 Protein | +Inquiry |
HTR4-5238H | Recombinant Human HTR4 Protein | +Inquiry |
SAA4-2498H | Recombinant Human SAA4 protein, His-TRxA-tagged | +Inquiry |
PSD3-2832H | Recombinant Human PSD3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
ZNF689-10463M | Recombinant Mouse ZNF689 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
B2M-5366H | Native Human Beta-2-Microglobulin | +Inquiry |
IgG-7439M | Native Mouse IgG Fc Protein | +Inquiry |
Lectin-1835R | Native Ricinus Communis Ricin A Chain Protein | +Inquiry |
PAP-01H | Active Native Human PAP | +Inquiry |
F7-5303H | Native Human Coagulation Factor VII, R-PE conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
ODF3-3597HCL | Recombinant Human ODF3 293 Cell Lysate | +Inquiry |
CD97-2475HCL | Recombinant Human CD97 cell lysate | +Inquiry |
IL17RA-2640HCL | Recombinant Human IL17RA cell lysate | +Inquiry |
SLC30A1-603HCL | Recombinant Human SLC30A1 lysate | +Inquiry |
FRMD6-284HCL | Recombinant Human FRMD6 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Nmur1 Products
Required fields are marked with *
My Review for All Nmur1 Products
Required fields are marked with *
0
Inquiry Basket