Recombinant Full Length Human Neuromedin-U Receptor 1(Nmur1) Protein, His-Tagged
Cat.No. : | RFL1904HF |
Product Overview : | Recombinant Full Length Human Neuromedin-U receptor 1(NMUR1) Protein (Q9HB89) (1-426aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-426) |
Form : | Lyophilized powder |
AA Sequence : | MTPLCLNCSVLPGDLYPGGARNPMACNGSAARGHFDPEDLNLTDEALRLKYLGPQQTELF MPICATYLLIFVVGAVGNGLTCLVILRHKAMRTPTNYYLFSLAVSDLLVLLVGLPLELYE MWHNYPFLLGVGGCYFRTLLFEMVCLASVLNVTALSVERYVAVVHPLQARSMVTRAHVRR VLGAVWGLAMLCSLPNTSLHGIRQLHVPCRGPVPDSAVCMLVRPRALYNMVVQTTALLFF CLPMAIMSVLYLLIGLRLRRERLLLMQEAKGRGSAAARSRYTCRLQQHDRGRRQVTKMLF VLVVVFGICWAPFHADRVMWSVVSQWTDGLHLAFQHVHVISGIFFYLGSAANPVLYSLMS SRFRETFQEALCLGACCHRLRPRHSSHSLSRMTTGSTLCDVGSLGSWVHPLAGNDGPEAQ QETDPS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | NMUR1 |
Synonyms | NMUR1; GPR66; Neuromedin-U receptor 1; NMU-R1; G-protein coupled receptor 66; G-protein coupled receptor FM-3 |
UniProt ID | Q9HB89 |
◆ Native Proteins | ||
TNNI1-49H | Native Human troponin I type 1 Protein | +Inquiry |
Collagen Type I-12P | Native Porcine Collagen Type I Protein | +Inquiry |
Saporin-30S | Native Saponaria officinalis ribosome-inactivating Protein | +Inquiry |
ACE-3047R | Native rabbit ACE | +Inquiry |
IgM-344D | Native Donkey IgM | +Inquiry |
◆ Cell & Tissue Lysates | ||
MAPK9-4487HCL | Recombinant Human MAPK9 293 Cell Lysate | +Inquiry |
ZBTB26-1953HCL | Recombinant Human ZBTB26 cell lysate | +Inquiry |
CD200R4-2441MCL | Recombinant Mouse CD200R4 cell lysate | +Inquiry |
TMEM74-932HCL | Recombinant Human TMEM74 293 Cell Lysate | +Inquiry |
NR2E1-1216HCL | Recombinant Human NR2E1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NMUR1 Products
Required fields are marked with *
My Review for All NMUR1 Products
Required fields are marked with *
0
Inquiry Basket