Recombinant Full Length Rat Germ Cell-Specific Gene 1 Protein(Gsg1) Protein, His-Tagged
Cat.No. : | RFL18906RF |
Product Overview : | Recombinant Full Length Rat Germ cell-specific gene 1 protein(Gsg1) Protein (Q6AYL2) (1-325aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-325) |
Form : | Lyophilized powder |
AA Sequence : | MEFQKGPSDQRTFVSAILNMLSLGLSTASLLSSEWFVGAQKVPKPLCGQSLAAKCFDMPM SLDGGITNASAQEVVQYTWEAGDDRFSFLTFRSGMWLSCEETVEEPGEKCRRFIELTPPA QREVLWLSLGAQTAYIGLQFISFLLLLTDLLLTSNPGCGLKLSAFAAVSLVLSGLLGMVA HMLYLQVFQATANLGPEDWRPHSWNYGWAFYTAWVSFTCCMVSAVTTFNTYTRMVLEFKC RHGTSFNTNPSCRAQHHRCFLPPLTCAVHAGEPSTSCHQHPSHPIRSVSESIDLYSAAAL QDKKFQQENSQELKEATESSVEEQC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Gsg1 |
Synonyms | Gsg1; Germ cell-specific gene 1 protein |
UniProt ID | Q6AYL2 |
◆ Native Proteins | ||
CVB5-13 | Native Coxsackievirus B5 Antigen | +Inquiry |
Phosphorylase B-49R | Active Native Rabbit Phosphorylase B | +Inquiry |
IgG-159B | Native Bovine Immunoglobulin G | +Inquiry |
C3-147C | Active Native Botulinum C3 Enzyme | +Inquiry |
HSV1-15 | Native Herpes Simplex Virus (HSV) Type 1 Antigen | +Inquiry |
◆ Cell & Tissue Lysates | ||
TPM1-844HCL | Recombinant Human TPM1 293 Cell Lysate | +Inquiry |
MYOD1-4005HCL | Recombinant Human MYOD1 293 Cell Lysate | +Inquiry |
MYBPH-4041HCL | Recombinant Human MYBPH 293 Cell Lysate | +Inquiry |
LOC391746-1013HCL | Recombinant Human LOC391746 cell lysate | +Inquiry |
CNR1-7395HCL | Recombinant Human CNR1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Gsg1 Products
Required fields are marked with *
My Review for All Gsg1 Products
Required fields are marked with *
0
Inquiry Basket