Recombinant Full Length Bovine Germ Cell-Specific Gene 1 Protein(Gsg1) Protein, His-Tagged
Cat.No. : | RFL24455BF |
Product Overview : | Recombinant Full Length Bovine Germ cell-specific gene 1 protein(GSG1) Protein (Q3SZT1) (1-323aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Bovine |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-323) |
Form : | Lyophilized powder |
AA Sequence : | MGLPKGFSSQRKRLSAVLNMLSLSLSTASLLSNYWFVGTQKVPKPLCGKGLPAKCFDVPV PLDGGGTNASSPEVVHYSWETGDDRFTFHAFRSGMWLSCAEIMEEPGERCRSFLELTPPT EREILWLSLGAQFAYIGLELISFILLLTDLLFTGNPGCSLKLSAFAAISSVLSGLLGMVG HMMYSQVFQATANLGPEDWRPHAWNYGWAFYTAWVSFTCCMASAVTTFNTYTRLVLEFKC RHSKSFRGAPGCQPHHHQCFLQQLACTAHPGGPVTSYPQFHCQPIRSISEGVDFYSELHD KELQQGSSQEPETKAAGSSVEEC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | GSG1 |
Synonyms | GSG1; Germ cell-specific gene 1 protein |
UniProt ID | Q3SZT1 |
◆ Recombinant Proteins | ||
ALK-49H | Recombinant Human ALK (T1151M), GST-tagged | +Inquiry |
YVRO-1966B | Recombinant Bacillus subtilis YVRO protein, His-tagged | +Inquiry |
CCR12A-4099Z | Recombinant Zebrafish CCR12A | +Inquiry |
ZGPAT-19172M | Recombinant Mouse ZGPAT Protein | +Inquiry |
GNG11-2606R | Recombinant Rat GNG11 Protein | +Inquiry |
◆ Native Proteins | ||
LOX3-11S | Native Soybeans LOX3 Protein | +Inquiry |
SERPIND1-12H | Native Human Heparin Cofactor II | +Inquiry |
Blood-011H | Human Blood Lysate, Total Protein | +Inquiry |
dnt-142B | Active Native Bordetella bronchiseptica Dermonecrotic Toxin | +Inquiry |
KLKB1-27924TH | Native Human KLKB1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
GALNT14-6037HCL | Recombinant Human GALNT14 293 Cell Lysate | +Inquiry |
ACOT9-15HCL | Recombinant Human ACOT9 cell lysate | +Inquiry |
SLC26A2-1754HCL | Recombinant Human SLC26A2 293 Cell Lysate | +Inquiry |
TFCP2L1-1133HCL | Recombinant Human TFCP2L1 293 Cell Lysate | +Inquiry |
COX19-7335HCL | Recombinant Human COX19 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All GSG1 Products
Required fields are marked with *
My Review for All GSG1 Products
Required fields are marked with *
0
Inquiry Basket