Recombinant Full Length Rat Emerin(Emd) Protein, His-Tagged
Cat.No. : | RFL6154RF |
Product Overview : | Recombinant Full Length Rat Emerin(Emd) Protein (Q63190) (1-260aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-260) |
Form : | Lyophilized powder |
AA Sequence : | MDDYAVLSDTELAAVLRQYNIPHGPILGSTRKLYEKKIFEYETQRRRLSPPSSSSSSFSY RFSDLDSASVDSDMYDLPKKEDALLYQSKDYNDDYYEESYLTTRTYGEPESVGMSKSFRR PGTSLVDADDTFHHQVRDDIFSSSEEEGKDRERPIYGRDSAYQSIAEYRPISNVSRSSLG LSYYPRSSTSSVSSSSSSPSSWLTRRAIRPEKQAPTAALGQDRQVPLWGQLLLFLAFATF LLFVYYSIQAQEGNPFWMDP |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Emd |
Synonyms | Emd; Emerin |
UniProt ID | Q63190 |
◆ Recombinant Proteins | ||
CD73-3020C | Active Recombinant Canine CD73 protein, His-tagged | +Inquiry |
Ryk-5663M | Recombinant Mouse Ryk Protein, Myc/DDK-tagged | +Inquiry |
DDHD2-2252M | Recombinant Mouse DDHD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
NAPEPLD-1799HFL | Recombinant Full Length Human NAPEPLD Protein, C-Flag-tagged | +Inquiry |
TRPS1-7752Z | Recombinant Zebrafish TRPS1 | +Inquiry |
◆ Native Proteins | ||
HBA1-8158H | Native Hemoglobin A1C (HbA1c) | +Inquiry |
HB-44R | Native Rabbit Hemoglobin (HB) Protein | +Inquiry |
fH-10R | Native Rat fH Protein | +Inquiry |
TSH-108H | Active Native Human Thyroid Stimulating Hormone | +Inquiry |
Lectin-1762A | Active Native Agaricus bisporus lectin Protein, Biotinylated | +Inquiry |
◆ Cell & Tissue Lysates | ||
TIGIT-2610HCL | Recombinant Human TIGIT cell lysate | +Inquiry |
SAMM50-2071HCL | Recombinant Human SAMM50 293 Cell Lysate | +Inquiry |
CXCR7-7159HCL | Recombinant Human CXCR7 293 Cell Lysate | +Inquiry |
KRTAP13-2-4851HCL | Recombinant Human KRTAP13 293 Cell Lysate | +Inquiry |
GATAD2B-6007HCL | Recombinant Human GATAD2B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Emd Products
Required fields are marked with *
My Review for All Emd Products
Required fields are marked with *
0
Inquiry Basket