Recombinant Full Length Rat Diacylglycerol O-Acyltransferase 1(Dgat1) Protein, His-Tagged
Cat.No. : | RFL2319RF |
Product Overview : | Recombinant Full Length Rat Diacylglycerol O-acyltransferase 1(Dgat1) Protein (Q9ERM3) (1-498aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-498) |
Form : | Lyophilized powder |
AA Sequence : | MGDRGGAGSSRRRRTGSRVSVQGGSGPKVEEDEVREAAVSPDLGAGGDAPAPAPAPAHTR DKDRQTSVGDGHWELRCHRLQDSLFSSDSGFSNYRGILNWCVVMLILSNARLSLENLIKY GILVDPIQVVSLFLKDPYSWPAPCLIIASNIFIVATFQIEKRLSVGALTEQMGLLLHVVN LATIICFPAAVALLVESITPVGSLFALASYSIIFLKLSSYRDVNLWCRQRRVKAKAVSAG KKVSGAAAQNTVSYPDNLTYRDLYYFIFAPTLCYELNFPRSPRIRKRFLLRRVLEMLFFT QLQVGLIQQWMVPTIQNSMKPFKDMDYSRIIERLLKLAVPNHLIWLIFFYWLFHSCLNAV AELLQFGDREFYRDWWNAESVTYFWQNWNIPVHKWCIRHFYKPMLRLGSNKWMARTGVFW ASAFFHEYLVSIPLRMFRLWAFTAMMAQVPLAWIVNRFFQGNYGNAAVWVTLIIGQPVAV LMYVHDYYVLNYDAPVGA |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Dgat1 |
Synonyms | Dgat1; Dgat; Diacylglycerol O-acyltransferase 1; Acyl-CoA retinol O-fatty-acyltransferase; ARAT; Retinol O-fatty-acyltransferase; Diglyceride acyltransferase |
UniProt ID | Q9ERM3 |
◆ Recombinant Proteins | ||
UGT2A3-7723Z | Recombinant Zebrafish UGT2A3 | +Inquiry |
GPR85-2324R | Recombinant Rat GPR85 Protein, His (Fc)-Avi-tagged | +Inquiry |
Oxt-4a-4324O | Recombinant Oxyopes foliiformis Oxt-4a protein, His-SUMO-tagged | +Inquiry |
RFL9302NF | Recombinant Full Length Nicotiana Tomentosiformis Cytochrome B559 Subunit Alpha(Psbe) Protein, His-Tagged | +Inquiry |
Top1-465M | Recombinant Mouse Top1 Protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
IgD-212H | Native Human Immunoglobulin D (IgD) | +Inquiry |
HbA1c-19M | Native Mouse Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
Collagen-322H | Native Human Collagen IV | +Inquiry |
SV40gp6-268 | Active Native Simian virus 40 SV40gp6 protein | +Inquiry |
ADPGK-45 | Active Native ADP-specific glucokinase | +Inquiry |
◆ Cell & Tissue Lysates | ||
OR51E2-3558HCL | Recombinant Human OR51E2 293 Cell Lysate | +Inquiry |
MTIF3-4079HCL | Recombinant Human MTIF3 293 Cell Lysate | +Inquiry |
GCA-5994HCL | Recombinant Human GCA 293 Cell Lysate | +Inquiry |
PCMTD1-1313HCL | Recombinant Human PCMTD1 cell lysate | +Inquiry |
G3BP2-6084HCL | Recombinant Human G3BP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Dgat1 Products
Required fields are marked with *
My Review for All Dgat1 Products
Required fields are marked with *
0
Inquiry Basket