Recombinant Human DGAT1 protein, His-tagged

• Cat.No.: DGAT1-27H
• Product Overview: Recombinant Human DGAT1 protein(200-300 aa), fused with N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 200-300 aa
• Tag: N-His
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4, 17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• Storage: Samples are stable for up to twelve months from date of receipt at -20°C to -80°C. Store it under sterile conditions at -20°C to -80°C. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage.
  After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
• AA Sequence: AHTILFLKLFSYRDVNSWCRRARAKAASAGKKASSAAAPHTVSYPDNLTYRDLYYFLFAPTLCYELNFPRSPRIRKRFLLRRILEMLFFTQLQVGLIQQWM

Gene Information

• Gene Name: DGAT1 diacylglycerol O-acyltransferase 1 [ Homo sapiens ]
• Official Symbol: DGAT1
• Synonyms: DGAT1; diacylglycerol O-acyltransferase 1; diacylglycerol O acyltransferase homolog 1 (mouse); ARGP1; DGAT; ACAT related gene product 1; ACAT-related gene product 1; diglyceride acyltransferase; diacylglycerol O-acyltransferase homolog 1; acyl coenzyme A:cholesterol acyltransferase related gene 1
• Gene ID: 8694
• mRNA Refseq: NM_012079
• Protein Refseq: NP_036211
• MIM: 604900
• UniProt ID: O75907