Recombinant Full Length Rat Cytochrome P450 4X1(Cyp4X1) Protein, His-Tagged
Cat.No. : | RFL27367RF |
Product Overview : | Recombinant Full Length Rat Cytochrome P450 4X1(Cyp4x1) Protein (Q8K4D6) (1-507aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-507) |
Form : | Lyophilized powder |
AA Sequence : | MEASWLENRWARPLHLALVFCLALVLMQAVKLYLRRQRLLRDLRPFPGPTAHWLLGHQKF LQEDNMEKLDEIVKEYPCAFPCWVGPFQAFFYIYDPDYAKIFLSRTDPKTQYLHQLMTPF LGRGLLNLDGPRWFQHRCLLTPAFHQDILKPCVDMMAHSVNMMLDKWEKTWTTQETTIEV FEHINLMTLDIIMKCAFGQETNCQINGTYESYVKATFELGEIISSRLYNFWHHHDIIFKL SPKGHCFQELGKVIHQCTEKIIQDRKKTLKDQVNQDDTQTSQNFLDIVLSAQAGDEKAFS DADLRSEVNTFMWAGHDASAASISWLLYCLALNPEHQDRCRTEIRSILGDGSSITWEQLD EIPYTTMCIKETLRLIPPIPSISRELSKPLTLPDGHSLPAGMTVVLSIWGLHHNPAVWKD PKVFDPLRFTKENSEQRHPCAFLPFSSGPRNCIGQQFAMLELKVAIALTLLRFRVAADLT RPPAFSSHTVLRPKHGIYLHLKKLPEC |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cyp4x1 |
Synonyms | Cyp4x1; Cytochrome P450 4X1; CYPIVX1 |
UniProt ID | Q8K4D6 |
◆ Recombinant Proteins | ||
RFL27367RF | Recombinant Full Length Rat Cytochrome P450 4X1(Cyp4X1) Protein, His-Tagged | +Inquiry |
RFL19004HF | Recombinant Full Length Human Cytochrome P450 4X1(Cyp4X1) Protein, His-Tagged | +Inquiry |
CYP4X1-11793H | Recombinant Human CYP4X1, His-tagged | +Inquiry |
Cyp4x1-2423M | Recombinant Mouse Cyp4x1 Protein, Myc/DDK-tagged | +Inquiry |
CYP4X1-1755R | Recombinant Rat CYP4X1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYP4X1-441HCL | Recombinant Human CYP4X1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cyp4x1 Products
Required fields are marked with *
My Review for All Cyp4x1 Products
Required fields are marked with *
0
Inquiry Basket