Recombinant Full Length Rat Cdgsh Iron-Sulfur Domain-Containing Protein 1(Cisd1) Protein, His-Tagged
Cat.No. : | RFL25516RF |
Product Overview : | Recombinant Full Length Rat CDGSH iron-sulfur domain-containing protein 1(Cisd1) Protein (B0K020) (2-108aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (2-108) |
Form : | Lyophilized powder |
AA Sequence : | GLSSDSPVRVEWIAAVTFAAGTAALGYLAYKKFYAKESRTKAMVNLQIQKDNPKVVHAFDMEDLGDKAVYCRCWRSKKFPFCDGAHIKHNEETGDNVGPLIIKKKET |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Cisd1 |
Synonyms | Cisd1; CDGSH iron-sulfur domain-containing protein 1; MitoNEET |
UniProt ID | B0K020 |
◆ Recombinant Proteins | ||
RFL25516RF | Recombinant Full Length Rat Cdgsh Iron-Sulfur Domain-Containing Protein 1(Cisd1) Protein, His-Tagged | +Inquiry |
CISD1-2118HFL | Recombinant Full Length Human CISD1 Protein, C-Flag-tagged | +Inquiry |
CISD1-10883Z | Recombinant Zebrafish CISD1 | +Inquiry |
CISD1-4365C | Recombinant Chicken CISD1 | +Inquiry |
CISD1-7153H | Recombinant Human CDGSH Iron Sulfur Domain 1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CISD1-7490HCL | Recombinant Human CISD1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Cisd1 Products
Required fields are marked with *
My Review for All Cisd1 Products
Required fields are marked with *
0
Inquiry Basket