Recombinant Full Length Human CISD1 Protein, C-Flag-tagged

• Cat.No.: CISD1-2118HFL
• Product Overview: Recombinant Full Length Human CISD1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This gene encodes a protein with a CDGSH iron-sulfur domain and has been shown to bind a redox-active [2Fe-2S] cluster. The encoded protein has been localized to the outer membrane of mitochondria and is thought to play a role in regulation of oxidation. Genes encoding similar proteins are located on chromosomes 4 and 17, and a pseudogene of this gene is located on chromosome 2.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 12 kDa
• AA Sequence: MSLTSSSSVRVEWIAAVTIAAGTAAIGYLAYKRFYVKDHRNKAMINLHIQKDNPKIVHAFDMEDLGDKAV YCRCWRSKKFPFCDGAHTKHNEETGDNVGPLIIKKKET myc-FLAG tag
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Transmembrane
• Full Length: Full L.

Gene Information

• Gene Name: CISD1 CDGSH iron sulfur domain 1 [ Homo sapiens (human) ]
• Official Symbol: CISD1
• Synonyms: ZCD1; MDS029; C10orf70; mitoNEET
• Gene ID: 55847
• mRNA Refseq: NM_018464.5
• Protein Refseq: NP_060934.1
• MIM: 611932
• UniProt ID: Q9NZ45