Recombinant Full Length Rat 6.8 Kda Mitochondrial Proteolipid(Mp68) Protein, His-Tagged
Cat.No. : | RFL26511RF |
Product Overview : | Recombinant Full Length Rat 6.8 kDa mitochondrial proteolipid(Mp68) Protein (D3Z9R8) (1-60aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Rat |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-60) |
Form : | Lyophilized powder |
AA Sequence : | MLQSFIKKVWVPMKPYYTQVYQEIWVGVGLMSLIVYKIRSADKRSKALKGCSPAHAHGHH |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Mp68 |
Synonyms | Atp5mj; Atp5mpl; Mp68; ATP synthase subunit ATP5MJ, mitochondrial; 6.8 kDa mitochondrial proteolipid; 6.8 kDa mitochondrial proteolipid protein; MLQ |
UniProt ID | D3Z9R8 |
◆ Native Proteins | ||
APOH-4217H | Native Human APOH protein | +Inquiry |
CCL25-31214TH | Native Human CCL25 | +Inquiry |
REN -16H | Recombinant Human Prorenin, His-tagged | +Inquiry |
C1QA-26126TH | Native Human C1QA | +Inquiry |
Egf -635R | Native Rat Egf protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
Spleen-467H | Human Spleen Lupus Lysate | +Inquiry |
SLC30A6-605HCL | Recombinant Human SLC30A6 lysate | +Inquiry |
RNFT2-550HCL | Recombinant Human RNFT2 lysate | +Inquiry |
Amygdala-1H | Human Amygdala(Alzheimer's Disease) Membrane Lysate | +Inquiry |
DEFB129-6981HCL | Recombinant Human DEFB129 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Mp68 Products
Required fields are marked with *
My Review for All Mp68 Products
Required fields are marked with *
0
Inquiry Basket