Recombinant Full Length Rabbit Potassium Voltage-Gated Channel Subfamily D Member 2(Kcnd2) Protein, His-Tagged
Cat.No. : | RFL12002OF |
Product Overview : | Recombinant Full Length Rabbit Potassium voltage-gated channel subfamily D member 2(KCND2) Protein (P59995) (1-630aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Oryctolagus cuniculus (Rabbit) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-630) |
Form : | Lyophilized powder |
AA Sequence : | MAAGVAAWLPFARAAAIGWMPVASGPMPAPPRQERKRTQDALIVLNVSGTRFQTWQDTLE RYPDTLLGSSERDFFYHPETQQYFFDRDPDIFRHILNFYRTGKLHYPRHECISAYDEELA FFGLIPEIIGDCCYEEYKDRRRENAERLQDDADTDNTCESALPTMTARQRVWRAFENPHT STMALVFYYVTGFFIAVSVIANVVETVPCGSSPGHIKELPCGERYAVAFFCLDTACVMIF TVEYLLRLAAAPSRYRFVRSVMSIIDVVAILPYYIGLVMTDNEDVSGAFVTLRVFRVFRI FKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPAA FWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRAD KRRAQKKARLARIRAAKSGSANAYMQSKRNGLLSNQLQSSEEEPAFVSKSGSSFETQHHH LLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRI PNANVSGSQRGSVQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISI PTPPVTTPEGDDRPESPEYSGGNIVRVSAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCND2 |
Synonyms | KCND2; Potassium voltage-gated channel subfamily D member 2; Voltage-gated potassium channel subunit Kv4.2 |
UniProt ID | P59995 |
◆ Recombinant Proteins | ||
MAPKAPK2-1366H | Recombinant Human MAPKAPK2 Protein, His (Fc)-Avi-tagged | +Inquiry |
WIZ-1499H | Recombinant Human WIZ protein, His&Myc-tagged | +Inquiry |
ARTN-5643H | Recombinant Human ARTN protein, hFc-tagged | +Inquiry |
BRAFLDRAFT_206907-1527B | Recombinant Branchiostoma floridae BRAFLDRAFT_206907 Protein (Gln20-Cys487), N-GST tagged | +Inquiry |
STEAP3-3002H | Recombinant Human STEAP3, His-tagged | +Inquiry |
◆ Native Proteins | ||
Collagen-44H | Native Human Collagen I | +Inquiry |
IgM-344D | Native Donkey IgM | +Inquiry |
KRT18-173B | Native bovine KRT18 | +Inquiry |
OAC-34 | Active Native Oxaloacetate decarboxylase | +Inquiry |
BIAP-76B | Native Bovine Intestinal Alkaline Phosphatase | +Inquiry |
◆ Cell & Tissue Lysates | ||
UBE4B-556HCL | Recombinant Human UBE4B 293 Cell Lysate | +Inquiry |
FMR1-6179HCL | Recombinant Human FMR1 293 Cell Lysate | +Inquiry |
Bladder-131R | Rat Bladder Tissue Lysate | +Inquiry |
TLE1-1051HCL | Recombinant Human TLE1 293 Cell Lysate | +Inquiry |
PDHA2-3333HCL | Recombinant Human PDHA2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCND2 Products
Required fields are marked with *
My Review for All KCND2 Products
Required fields are marked with *
0
Inquiry Basket