Recombinant Full Length Human Potassium Voltage-Gated Channel Subfamily D Member 2(Kcnd2) Protein, His-Tagged
Cat.No. : | RFL6477HF |
Product Overview : | Recombinant Full Length Human Potassium voltage-gated channel subfamily D member 2(KCND2) Protein (Q9NZV8) (1-630aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-630) |
Form : | Lyophilized powder |
AA Sequence : | MAAGVAAWLPFARAAAIGWMPVASGPMPAPPRQERKRTQDALIVLNVSGTRFQTWQDTLE RYPDTLLGSSERDFFYHPETQQYFFDRDPDIFRHILNFYRTGKLHYPRHECISAYDEELA FFGLIPEIIGDCCYEEYKDRRRENAERLQDDADTDTAGESALPTMTARQRVWRAFENPHT STMALVFYYVTGFFIAVSVIANVVETVPCGSSPGHIKELPCGERYAVAFFCLDTACVMIF TVEYLLRLAAAPSRYRFVRSVMSIIDVVAILPYYIGLVMTDNEDVSGAFVTLRVFRVFRI FKFSRHSQGLRILGYTLKSCASELGFLLFSLTMAIIIFATVMFYAEKGSSASKFTSIPAA FWYTIVTMTTLGYGDMVPKTIAGKIFGSICSLSGVLVIALPVPVIVSNFSRIYHQNQRAD KRRAQKKARLARIRAAKSGSANAYMQSKRNGLLSNQLQSSEDEQAFVSKSGSSFETQHHH LLHCLEKTTNHEFVDEQVFEESCMEVATVNRPSSHSPSLSSQQGVTSTCCSRRHKKTFRI PNANVSGSHQGSIQELSTIQIRCVERTPLSNSRSSLNAKMEECVKLNCEQPYVTTAIISI PTPPVTTPEGDDRPESPEYSGGNIVRVSAL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCND2 |
Synonyms | KCD2; KCND 2; KCND2; KCND2_HUMAN; KIAA1044; MGC119702; MGC119703; Potassium voltage gated channel Shal related subfamily member 2; Potassium voltage-gated channel subfamily D member 2; RK 5; RK5; Voltage gated potassium channel Kv4.2; Voltage gated potass |
UniProt ID | Q9NZV8 |
◆ Recombinant Proteins | ||
FOLH1-784H | Recombinant Human FOLH1 protein, His-tagged | +Inquiry |
Lyrm2-387M | Recombinant Mouse Lyrm2 Protein, MYC/DDK-tagged | +Inquiry |
CD70-437H | Recombinant Human CD70 Protein (Gln39-Pro193), RIgG Fc-tagged | +Inquiry |
RFL31444SF | Recombinant Full Length Saccharomyces Cerevisiae Putative Uncharacterized Protein Ygl041C (Ygl041C) Protein, His-Tagged | +Inquiry |
Csf2-8907R | Active Recombinant Rat Csf2 | +Inquiry |
◆ Native Proteins | ||
ALB-03C | Native Cynomolgus Monkey ALB protein | +Inquiry |
GGT1-667H | Native Human Gamma-Glutamyl Transferase 1 | +Inquiry |
IBV-06I | Native Influenza B Antigen | +Inquiry |
RPE-135 | Native Red algae R-Phycoerythrin protein | +Inquiry |
BSA-01 | Native Bovine Serum Albumin | +Inquiry |
◆ Cell & Tissue Lysates | ||
FKBP6-6203HCL | Recombinant Human FKBP6 293 Cell Lysate | +Inquiry |
HIST1H1B-5554HCL | Recombinant Human HIST1H1B 293 Cell Lysate | +Inquiry |
EXOSC8-6498HCL | Recombinant Human EXOSC8 293 Cell Lysate | +Inquiry |
Eye-488C | Chicken Eye Lysate, Total Protein | +Inquiry |
GYS1-5670HCL | Recombinant Human GYS1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All KCND2 Products
Required fields are marked with *
My Review for All KCND2 Products
Required fields are marked with *
0
Inquiry Basket