Recombinant Full Length Putative Udp-Glucuronosyltransferase Ugt-48(Ugt-48) Protein, His-Tagged
Cat.No. : | RFL7605CF |
Product Overview : | Recombinant Full Length Putative UDP-glucuronosyltransferase ugt-48(ugt-48) Protein (Q18081) (18-526aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Caenorhabditis elegans |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length of Mature Protein (18-526) |
Form : | Lyophilized powder |
AA Sequence : | HKILMFSPTASKSHMISQGRIADELANAGHEVVNFEPDFLNLTDKFVPCKKCRRWPVTGL NNYKFKKIQNGLSGDVFQQSSIWSKIFNTDSDPYQDEYTNMCEEMVTNKELIEKLKKEKF DAYFGEQIHLCGMGLAHLIGIKHRFWIASCTMSVSMRDSLGIPTPSSLIPFMSTLDATPA PFWQRAKNFVLQMAHIRDEYRDVVLTNDMFKKNFGSDFPCVEFLAKTSDLIFVSTDELLE IQAPTLSNVVHIGGLGLSSEGGGLDEKFVKIMEKGKGVILFSLGTIANTTNLPPTIMENL MKITQKFKDYEFIIKVDKFDRRSFDLAEGLSNVLVVDWVPQTAVLAHPRLKAFITHAGYN SLMESAYAGVPVILIPFMFDQPRNGRSVERKGWGILRDRFQLIKDPDAIEGAIKEILVNP TYQEKANRLKKLMRSKPQSASERLVKMTNWVLENDGVEELQYEGKHMDFFTFYNLDIIIT AASIPVLIFIVLRISNISIITSSPKNKKD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | ugt-48 |
Synonyms | ugt-48; ugt15; C18C4.3; Putative UDP-glucuronosyltransferase ugt-48; UDPGT 48 |
UniProt ID | Q18081 |
◆ Native Proteins | ||
HGF-29231TH | Native Human HGF | +Inquiry |
LDH-228H | Native Human Lactate Dehydrogenase Total | +Inquiry |
GPT-189P | Active Native Porcine Glutamate Pyruvate Transaminase (GPT), Alanine Transaminase (ALT) | +Inquiry |
imALB-36H | Native Human Ischemia Modified Albumin (IMA) Protein | +Inquiry |
CKB-1177H | Native Human Creatine Kinase, Brain | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCNK10-646HCL | Recombinant Human KCNK10 Lysate | +Inquiry |
UTP14A-447HCL | Recombinant Human UTP14A 293 Cell Lysate | +Inquiry |
TUBGCP2-642HCL | Recombinant Human TUBGCP2 293 Cell Lysate | +Inquiry |
Frontal Lobe-190R | Rhesus monkey Frontal Lobe Lysate | +Inquiry |
GLT1D1-715HCL | Recombinant Human GLT1D1 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ugt-48 Products
Required fields are marked with *
My Review for All ugt-48 Products
Required fields are marked with *
0
Inquiry Basket