Recombinant Full Length Pseudomonas Phage Pf3 Attachment Protein G3P(Iii) Protein, His-Tagged
Cat.No. : | RFL8654PF |
Product Overview : | Recombinant Full Length Pseudomonas phage Pf3 Attachment protein G3P(III) Protein (P03624) (21-483aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas phage Pf3 (Bacteriophage Pf3) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (21-483) |
Form : | Lyophilized powder |
AA Sequence : | AGPVSTEVAAGTTTYRVTNTTVRTPPNVTLSPVRDITPYVEKIPNKGLAQAAQGRLIVAQ RAASVPVTGFFNVSGAVVKSGAKSFLRSAGRASGIGLGLAALLEAADWVFDEEGEIVKPL PGGGSPVLMPRPVILNEYTVTGSAGQWSISKEYEPDPRSVPGWYSYNGNPVWVSAVEDVG FTWRYWYFADVLMDGQGRPNYLVAYSDSGPNEYWQDVGGYSLDSLPTEPEFVPLTDAELE AGIDQYYEPDPDDWRNLFPYIEPDSFTIETPIPSLDLSPVVSSSTNNQTGKVTVTETTTS VDFEVSDNNSSQPSISVNETTTENVYVDGDLVSSETNTTVTNPPSSGTSTPPSSGSGSDF QLPSFCSWATAVCDWFDWTQEPIDEEPDLSGIISDIDDLERTKDISFGSKSCPAPIALDI EFLDMSVDLSFEWFCELAGIIYFMVMASAYVLAAYITLGVVRG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | III |
Synonyms | III; Attachment protein G3P; Gene 3 protein; G3P; Minor coat protein |
UniProt ID | P03624 |
◆ Recombinant Proteins | ||
CIART-701R | Recombinant Rhesus Macaque CIART Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL28597UF | Recombinant Full Length Ustilago Maydis Mitochondrial Import Inner Membrane Translocase Subunit Tim50(Tim50) Protein, His-Tagged | +Inquiry |
NUDT22-10973M | Recombinant Mouse NUDT22 Protein | +Inquiry |
MS4A1-278H | Recombinant Human MS4A1, Fc-tagged, Biotinylated | +Inquiry |
SLMO1-8450M | Recombinant Mouse SLMO1 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
MMP11-27648TH | Native Human MMP11 | +Inquiry |
MPO-8220H | Native Human Neutrophil Myeloperoxidase | +Inquiry |
Actin-340R | Native Rabbit Actin Protein | +Inquiry |
FSME-07 | Native FSME (TBE) Virus Antigen | +Inquiry |
PTGS1-58S | Native Sheep PTGS1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
FXYD3-6100HCL | Recombinant Human FXYD3 293 Cell Lysate | +Inquiry |
Stomach-485G | Guinea Pig Stomach Lysate | +Inquiry |
PCGF6-1310HCL | Recombinant Human PCGF6 cell lysate | +Inquiry |
PRKCB-2859HCL | Recombinant Human PRKCB 293 Cell Lysate | +Inquiry |
PRAMEF10-2894HCL | Recombinant Human PRAMEF10 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All III Products
Required fields are marked with *
My Review for All III Products
Required fields are marked with *
0
Inquiry Basket