Recombinant Full Length Pseudomonas Phage Pf1 Uncharacterized Protein Orf424 Protein, His-Tagged
Cat.No. : | RFL3507PF |
Product Overview : | Recombinant Full Length Pseudomonas phage Pf1 Uncharacterized protein ORF424 Protein (P25131) (1-424aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas phage Pf1 (Bacteriophage Pf1) |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-424) |
Form : | Lyophilized powder |
AA Sequence : | MSIKIHHGPNGSYKTSGAIQDDAVPALKDGRVIITNVRGFTLERAYQVFPDLPNTAEIIN LDLESLEDLEKMRTWFQWAPRGAFLIFDETQLLFPKSWREKDLERFDYPGGPEAAHAADR PMGWLDAWTRHRHFNWDIVLTTPNISYIRDDIRMTCEMAYKHSNLAVIGIPGRYKEAQHD AQLNRPPADGTIIEYKRIRKQTFALYQSTATGKTQDTKAGKSLFRSPKLVLLLALLAGTI GFVWYMGPLRTIGGPAAATPADAPGDPAQAPAAPAAVAAPARPAANSFLPPGLVPDGPAA APVDLNAHPFADRRISILAHAYRKSRGDIYMFALEDPTGRHLELTSWQLIGSGYRVTPKG ECVVELRYEDWKQTVTCAGRQAGAVASIAPAAPVAASADAPARGQSPLTIVPDSEYASRP WRQK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Pseudomonas phage Pf1 Uncharacterized protein ORF424 |
Synonyms | Uncharacterized protein ORF424; ORF 424 |
UniProt ID | P25131 |
◆ Recombinant Proteins | ||
LAIR1-1705R | Recombinant Rhesus Monkey LAIR1 Protein, hIgG4-tagged | +Inquiry |
Nog-1770M | Recombinant Mouse Noggin | +Inquiry |
RFL11225PF | Recombinant Full Length Cytochrome B6(Petb) Protein, His-Tagged | +Inquiry |
PRX-7196M | Recombinant Mouse PRX Protein, His (Fc)-Avi-tagged | +Inquiry |
CCDC50-517H | Recombinant Human CCDC50 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
CEACAM5-27803TH | Native Human CEACAM5 | +Inquiry |
CA2-32S | Native Sheep Carbonic Anhydrase II (CA2) Protein | +Inquiry |
LDH-216S | Active Native Porcine Lactate Dehydrogenase | +Inquiry |
REN-388H | Active Native Human Renin Antigen | +Inquiry |
CMA1-35H | Active Native Human CMA1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PCP2-3373HCL | Recombinant Human PCP2 293 Cell Lysate | +Inquiry |
TM9SF4-1030HCL | Recombinant Human TM9SF4 293 Cell Lysate | +Inquiry |
RSBN1-569HCL | Recombinant Human RSBN1 lysate | +Inquiry |
ZBTB44-214HCL | Recombinant Human ZBTB44 293 Cell Lysate | +Inquiry |
TCEANC2-8145HCL | Recombinant Human C1orf83 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All Pseudomonas phage Pf1 Uncharacterized protein ORF424 Products
Required fields are marked with *
My Review for All Pseudomonas phage Pf1 Uncharacterized protein ORF424 Products
Required fields are marked with *
0
Inquiry Basket