Recombinant Full Length Pseudomonas Fluorescens Macrolide Export Atp-Binding/Permease Protein Macb 2(Macb2) Protein, His-Tagged
Cat.No. : | RFL12404PF |
Product Overview : | Recombinant Full Length Pseudomonas fluorescens Macrolide export ATP-binding/permease protein MacB 2(macB2) Protein (Q3KE48) (1-651aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas fluorescens |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-651) |
Form : | Lyophilized powder |
AA Sequence : | MSEPLLQLTGISRSFTAGDREFLALKNIDLTIHAGEMVAIIGASGSGKSTLMNILGCLDY ATAGSYRINGRETRDLDNQALAELRRDYFGFIFQRYHLLPHLSAVHNVEMPAIYAGTPEP QRHARARELLARLGLEGHLTHRPSQLSGGQQQRVSIARALMNGGEVILADEPTGALDTTS GKEVMRILLELHAAGHTVILVTHDPKVAANAERIIEVSDGEILSDRRNERDTAALSNEDA VPKSTAARRLVASLGLFKEAFNMAWVALISHRMRTLLTMLGIVIGITSVVSISAIGEGAK RYVLKDIQAIGSNTIDIYSGTSFGDSRSAAIETLVPADVTALNQLYYVDSATPVVGRNLL LRYRNIDLDAQVNGVSDLYFQVRGIKMESGIPFSESDARRQAQVVVIDHNTRHRLFGEGV DPLGQVILIGNLPCTVIGVAAENKNIFSSSKSLNVWVPYETAAGRLLGQRYLDSISVRIK DGQPSKVVEDNVNKLMLQRHGTKDFFTNNLDSVMQTVQKTSRSLALLLSLIAVISLVVGG IGVMNIMLVSVTERTREIGIRMAVGARQSDIRQQFLVEAVMVCLLGGAIGISLSYAIGHL FSLFIKEWEMVFSLTSVLTAVICSTLIGIVFGFVPARNASRLDPIEALARD |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | macB2 |
Synonyms | macB2; Pfl01_2215; Macrolide export ATP-binding/permease protein MacB 2 |
UniProt ID | Q3KE48 |
◆ Recombinant Proteins | ||
ACYP2-1195HFL | Recombinant Full Length Human ACYP2 Protein, C-Flag-tagged | +Inquiry |
PABPN1-5999Z | Recombinant Zebrafish PABPN1 | +Inquiry |
NEFH-1255H | Recombinant Human NEFH protein, His/SUMO-tagged | +Inquiry |
IFNA21-3100H | Recombinant Human IFNA21 Protein (Asp25-Glu189), N-GST tagged | +Inquiry |
ARL6-232R | Recombinant Rhesus Macaque ARL6 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
BCHE-5291H | Native Human Butyrylcholinesterase | +Inquiry |
APC-137 | Native Spirulina sp. Allophycocyanin protein | +Inquiry |
LOX3-185G | Native Glycine max LOX3 Protein | +Inquiry |
Lipoxidase-37S | Active Native Soybean Lipoxidase | +Inquiry |
MB-8226H | Native Human Heart Myoglobin | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLA-DOA-5502HCL | Recombinant Human HLA 293 Cell Lysate | +Inquiry |
KLHL1-4915HCL | Recombinant Human KLHL1 293 Cell Lysate | +Inquiry |
KIAA1958-4957HCL | Recombinant Human KIAA1958 293 Cell Lysate | +Inquiry |
KRCC1-4884HCL | Recombinant Human KRCC1 293 Cell Lysate | +Inquiry |
DLG4-6910HCL | Recombinant Human DLG4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All macB2 Products
Required fields are marked with *
My Review for All macB2 Products
Required fields are marked with *
0
Inquiry Basket