Recombinant Full Length Pseudomonas Aeruginosa Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged
Cat.No. : | RFL32441PF |
Product Overview : | Recombinant Full Length Pseudomonas aeruginosa Undecaprenyl-diphosphatase(uppP) Protein (Q9I2E5) (1-277aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas aeruginosa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-277) |
Form : | Lyophilized powder |
AA Sequence : | MEWWTAFQAFILGVVEGLTEFLPISSTGHQIIVADLIGFGGERAKAFNIIIQLAAILAVV WEFRGKIFQVVRDLPSQRQAQRFTANLLIAFFPAVVLGVLFADLIHEWLFNPITVALALV VGGVVMLWAERRKHVIRAEHVDDMTWKDALKIGCAQCLAMIPGTSRSGATIIGGLLFGLS RKAATEFSFFLAMPTMVGAAVYSGYVYRDLFRPEDLPVFAVGFVTSFVFAMLAVRALLKF IGNHSYAAFAWYRIAFGLLILATWQFHLIDWSTAGEV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | uppP |
Synonyms | uppP; bacA; upk; PA1959; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase |
UniProt ID | Q9I2E5 |
◆ Native Proteins | ||
FN1-700H | Native Human Fibronectin 1 | +Inquiry |
Lectin-1805L | Active Native Lycopersicon Esculentum Lectin Protein, Fluorescein labeled | +Inquiry |
TG-393H | Native Human Thyroglobulin | +Inquiry |
Prothrombin-92M | Native Mouse Prothrombin | +Inquiry |
GLDH-213B | Active Native Bovine Glutamate Dehydrogenase | +Inquiry |
◆ Cell & Tissue Lysates | ||
CASP4-7837HCL | Recombinant Human CASP4 293 Cell Lysate | +Inquiry |
NAP1L2-3976HCL | Recombinant Human NAP1L2 293 Cell Lysate | +Inquiry |
CYBRD1-7137HCL | Recombinant Human CYBRD1 293 Cell Lysate | +Inquiry |
NCR2-2109HCL | Recombinant Human NCR2 cell lysate | +Inquiry |
CD300LG-1061HCL | Recombinant Human CD300LG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All uppP Products
Required fields are marked with *
My Review for All uppP Products
Required fields are marked with *
0
Inquiry Basket