Recombinant Full Length Trichodesmium Erythraeum Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged
Cat.No. : | RFL10912TF |
Product Overview : | Recombinant Full Length Trichodesmium erythraeum Undecaprenyl-diphosphatase(uppP) Protein (Q10VH5) (1-312aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Trichodesmium erythraeum |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-312) |
Form : | Lyophilized powder |
AA Sequence : | MKFFCAFIFTALIFISLEKIGQSCCPNPIVDSEQLTIFQAVILGMVQGVTECIPVSSTAH LKIIPVALGWGDPGVAFTAVIQLGSIVSIVWYFWNDLTKITFGAYKSIITSDYQSPDLKM LVSIGLGTIPIVFFGLLIKVFIPDFDNSRLRSTVAIAIASIIMALLLVIAERIGSRKRNF EKLDIRDGIVIGLAQVLALIPGVSRSGSTITGGLFIGLERSTAARFSFLLGLPAITLAGL VELKTLLDEGFGSVGLVATLTGVFSAIIFSYIAISWLMRYLQTQDTWIFIWYRLAFGILI LIGIISGVIENT |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | uppP |
Synonyms | uppP; Tery_4798; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase |
UniProt ID | Q10VH5 |
◆ Recombinant Proteins | ||
GGA1-5444HF | Recombinant Full Length Human GGA1 Protein, GST-tagged | +Inquiry |
ARMC8-3333H | Recombinant Human ARMC8 protein, His-tagged | +Inquiry |
FGG-730C | Recombinant Chicken FGG Protein, His-tagged | +Inquiry |
xylB-1424C | Recombinant Caulobacter vibrioides xylB Protein (S2-R248), His/Strep-tagged | +Inquiry |
ARG1-0629H | Recombinant Human ARG1 Protein (Met1-lys322), C-His-tagged | +Inquiry |
◆ Native Proteins | ||
Lectin-1774E | Active Native Erythrina Cristagalli Lectin Protein, Fluorescein labeled | +Inquiry |
PRTN3-01H | Native Human PRTN3 Protein | +Inquiry |
SAP-96H | Native Human Serum amyloid P | +Inquiry |
MMP2-29475TH | Native Human MMP2 | +Inquiry |
FTH1-001H | Native Horse FTH1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CAB39L-7911HCL | Recombinant Human CAB39L 293 Cell Lysate | +Inquiry |
OR1A2-458HCL | Recombinant Human OR1A2 lysate | +Inquiry |
CTAG1A-204HCL | Recombinant Human CTAG1A lysate | +Inquiry |
AICDA-8958HCL | Recombinant Human AICDA 293 Cell Lysate | +Inquiry |
PSMB4-2772HCL | Recombinant Human PSMB4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All uppP Products
Required fields are marked with *
My Review for All uppP Products
Required fields are marked with *
0
Inquiry Basket