Recombinant Full Length Pseudomonas Aeruginosa Undecaprenyl-Diphosphatase(Uppp) Protein, His-Tagged
Cat.No. : | RFL22091PF |
Product Overview : | Recombinant Full Length Pseudomonas aeruginosa Undecaprenyl-diphosphatase(uppP) Protein (A6V6L2) (1-277aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas aeruginosa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-277) |
Form : | Lyophilized powder |
AA Sequence : | MEWWTAFQAFILGVVEGLTEFLPISSTGHQIIVADLIGFGGERAKAFNIIIQLAAILAVV WEFRGKIFQVVRDLPSQHQAQRFTVNLLIAFFPAVILGVLFADLIHEWLFNPITVALALV VGGVIMLWAERRQHVIRAEHVDDMTWKDALKIGCAQCLAMVPGTSRSGATIIGGLLFGLS RKAATEFSFFLAMPTMVGAAVYSGYKYRELFRPEDLPVFAVGFVTSFVFAMVAVRALLKF IGNHSYAAFAWYRIAFGLLILATWQFHLIDWSTAGDL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | uppP |
Synonyms | uppP; PSPA7_3337; Undecaprenyl-diphosphatase; Bacitracin resistance protein; Undecaprenyl pyrophosphate phosphatase |
UniProt ID | A6V6L2 |
◆ Recombinant Proteins | ||
LDHD-1138H | Recombinant Human LDHD protein, His & GST-tagged | +Inquiry |
PTPRN-678H | Recombinant Human PTPRN Protein, His-tagged | +Inquiry |
Fzr1-3120M | Recombinant Mouse Fzr1 Protein, Myc/DDK-tagged | +Inquiry |
FCHO2-3192M | Recombinant Mouse FCHO2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CAMK2N2-5607H | Recombinant Human CAMK2N2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Native Proteins | ||
CAPN1-65P | Active Native Porcine Porcine Calpain 1 | +Inquiry |
PLG-8H | Native Human Plasminogen, FITC Labeled | +Inquiry |
PNLIP-8205H | Native Human Pancreas Lipase | +Inquiry |
PRF1-55H | Native Human Perforin | +Inquiry |
lalp-237H | Active Native Human Inter Alpha Inhibitor Proteins (IaIp) | +Inquiry |
◆ Cell & Tissue Lysates | ||
FAM169B-650HCL | Recombinant Human FAM169B cell lysate | +Inquiry |
RPL36A-2198HCL | Recombinant Human RPL36A 293 Cell Lysate | +Inquiry |
SLC5A2-1709HCL | Recombinant Human SLC5A2 293 Cell Lysate | +Inquiry |
IMPA1-5214HCL | Recombinant Human IMPA1 293 Cell Lysate | +Inquiry |
C20orf7-8111HCL | Recombinant Human C20orf7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All uppP Products
Required fields are marked with *
My Review for All uppP Products
Required fields are marked with *
0
Inquiry Basket