Recombinant Full Length Pseudomonas Aeruginosa Sensor Protein Pils(Pils) Protein, His-Tagged
Cat.No. : | RFL16866PF |
Product Overview : | Recombinant Full Length Pseudomonas aeruginosa Sensor protein pilS(pilS) Protein (P33639) (1-530aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas aeruginosa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-530) |
Form : | Lyophilized powder |
AA Sequence : | MRAERLRLSEEQGQRILRLYHLYRLTIGLVLVLLISSELEDQVLKLVHPELFHVGSWCYL VFNILVALFLPPSRQLLPIFILALTDVLMLCGLFYAGGGVPSGIGSLLVVAVAIANILLR GRIGLVIAAAASLGLLYLTFFLSLSSPDATNHYVQAGGLGTLCFAAALVIQALVRRQEQT ETLAEERAETVANLEELNALILQRMRTGILVVDSRQAILLANQAALGLLRQDDVQGASLG RHSPMLMHCMKQWRLNPSLRPPTLKVVPDGPTVQPSFISLNREDDQHVLIFLEDISQIAQ QAQQMKLAGLGRLTAGIAHEIRNPLGAISHAAQLLQESEELDAPDRRLTQIIQDQSKRMN LVIENVLQLSRRRQAEPQQLDLKEWLQRFVDEYPGRLRNDSQLHLQLGAGDIQTRMDPHQ LNQVLSNLVQNGLRYSAQAHGRGQVWLSLARDPESDLPVLEVIDDGPGVPADKLNNLFEP FFTTESKGTGLGLYLSRELCESNQARIDYRNREEGGGCFRITFAHPRKLS |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | pilS |
Synonyms | pilS; PA4546; Sensor protein kinase PilS |
UniProt ID | P33639 |
◆ Recombinant Proteins | ||
SPOPL-2930H | Recombinant Human SPOPL, His-tagged | +Inquiry |
STEAP1-5801H | Recombinant Human STEAP1 Protein (Met1-His72), N-GST tagged | +Inquiry |
RFL25416CF | Recombinant Full Length Clostridium Beijerinckii Atp Synthase Subunit B(Atpf) Protein, His-Tagged | +Inquiry |
IL23R-0271C | Active Recombinant Cynomolgus IL23R protein, Fc-tagged | +Inquiry |
HSPB3-5116H | Recombinant Human HSPB3 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
Fibrinogen-70P | Active Native Porcine Fibrinogen | +Inquiry |
MARCKS-12B | Native Bovine MARCKS protein | +Inquiry |
HbA1c-20R | Native Rat Glycated Hemoglobin A1c (HbA1c) Protein | +Inquiry |
TF-62H | Native Human Apo Transferrin Protein, Tag Free | +Inquiry |
C8-57H | Native Human Complement C8 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RNF34-2279HCL | Recombinant Human RNF34 293 Cell Lysate | +Inquiry |
Testis-807G | Guinea Pig Testis Membrane Lysate, Total Protein | +Inquiry |
CLIP3-7443HCL | Recombinant Human CLIP3 293 Cell Lysate | +Inquiry |
CHMP4B-186HCL | Recombinant Human CHMP4B lysate | +Inquiry |
DEF8-6992HCL | Recombinant Human DEF8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All pilS Products
Required fields are marked with *
My Review for All pilS Products
Required fields are marked with *
0
Inquiry Basket