Recombinant Full Length Pseudomonas Aeruginosa Alkane 1-Monooxygenase 2(Alkb2) Protein, His-Tagged
Cat.No. : | RFL17909PF |
Product Overview : | Recombinant Full Length Pseudomonas aeruginosa Alkane 1-monooxygenase 2(alkB2) Protein (Q6H941) (1-377aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Pseudomonas aeruginosa |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-377) |
Form : | Lyophilized powder |
AA Sequence : | MFASLSSAWMLRLKKYGYWIWLIAVLGIPLSYWWSLGSDYPNAWPWLVISVVFGLIPILD AIVGRDPANPEEASEVPEMEAQGYYRVLSLATVPLLLGMLVWSGWILAHETRWDWVGQLG WILSVGTVMGAIGITVSHELIHKDPQLEQNAGGLLLAAVCYAGFKVEHVRGHHVHVSTPE DASSSRYGQSLYSFLPHAYKHNFLNAWRLEAERLKRKGLPALHWRNELIWWYAISALFLL GFSLAFGWLGAIFFLGQSVMAFTLLEIVNYVEHYGLHRRRLDNGRYERTTPEHSWNSNFL LTNLFLFHLQRHSDHHAYAKRRYQVLRHYDSSPQLPNGYAGMIVLALFPPLWRAVMDPKV RAYYAGEEYQLTDTQRI |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | alkB2 |
Synonyms | alkB2; PA1525; Alkane 1-monooxygenase 2; Alkane hydroxylase; AHs; Terminal alkane hydroxylase |
UniProt ID | Q6H941 |
◆ Native Proteins | ||
BNP-1276P | Native Porcine Brain Natriuretic Peptide | +Inquiry |
F9-671H | Native Human Coagulation Factor IX | +Inquiry |
CVB1-12 | Native Coxsackievirus B1 Antigen | +Inquiry |
Hemocyanin-031H | Native Helix pomatia Hemocyanin Protein | +Inquiry |
PRL-111S | Active Native Sheep Prolactin | +Inquiry |
◆ Cell & Tissue Lysates | ||
PPAP2B-2991HCL | Recombinant Human PPAP2B 293 Cell Lysate | +Inquiry |
SLC25A42-1761HCL | Recombinant Human SLC25A42 293 Cell Lysate | +Inquiry |
KAL1-5093HCL | Recombinant Human KAL1 293 Cell Lysate | +Inquiry |
PCSK2-3371HCL | Recombinant Human PCSK2 293 Cell Lysate | +Inquiry |
SCO2-2025HCL | Recombinant Human SCO2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All alkB2 Products
Required fields are marked with *
My Review for All alkB2 Products
Required fields are marked with *
0
Inquiry Basket